Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

K5WRH7

Protein Details
Accession K5WRH7    Localization Confidence Medium Confidence Score 11
NoLS Segment(s)
PositionSequenceProtein Nature
58-81ELARDEENKKRKKKRLPPLVGPIFBasic
NLS Segment(s)
PositionSequence
65-73NKKRKKKRL
Subcellular Location(s) nucl 9, mito 5, cyto 5, cyto_mito 5, plas 2, golg 2, vacu 2
Family & Domain DBs
KEGG abp:AGABI1DRAFT134970  -  
Amino Acid Sequences MVCSLFVRRINHYDLDGITTIRGLILFLQDNPQAFSFEPPELPRHADESWPAYRRELELARDEENKKRKKKRLPPLVGPIFLHESIEFVRHWNVWEMDEGWGDIFRAIERGTKPVSQAVLKRGRRGLIFFYLVYERFCFFAYLSLRPRQLDTDS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.29
2 0.3
3 0.25
4 0.21
5 0.17
6 0.14
7 0.13
8 0.1
9 0.09
10 0.06
11 0.05
12 0.08
13 0.09
14 0.1
15 0.14
16 0.15
17 0.16
18 0.17
19 0.17
20 0.16
21 0.15
22 0.17
23 0.16
24 0.16
25 0.17
26 0.17
27 0.19
28 0.2
29 0.22
30 0.2
31 0.21
32 0.21
33 0.2
34 0.2
35 0.23
36 0.28
37 0.28
38 0.27
39 0.24
40 0.25
41 0.24
42 0.27
43 0.24
44 0.21
45 0.24
46 0.25
47 0.27
48 0.31
49 0.32
50 0.35
51 0.41
52 0.47
53 0.51
54 0.58
55 0.65
56 0.7
57 0.78
58 0.82
59 0.84
60 0.84
61 0.82
62 0.83
63 0.78
64 0.68
65 0.58
66 0.49
67 0.4
68 0.32
69 0.25
70 0.14
71 0.11
72 0.1
73 0.11
74 0.09
75 0.08
76 0.09
77 0.09
78 0.1
79 0.12
80 0.13
81 0.12
82 0.13
83 0.13
84 0.13
85 0.13
86 0.12
87 0.09
88 0.08
89 0.08
90 0.07
91 0.06
92 0.05
93 0.06
94 0.06
95 0.11
96 0.11
97 0.15
98 0.17
99 0.18
100 0.2
101 0.21
102 0.24
103 0.23
104 0.26
105 0.32
106 0.39
107 0.41
108 0.45
109 0.45
110 0.46
111 0.44
112 0.43
113 0.39
114 0.35
115 0.35
116 0.29
117 0.29
118 0.29
119 0.28
120 0.27
121 0.23
122 0.18
123 0.17
124 0.18
125 0.15
126 0.13
127 0.19
128 0.2
129 0.26
130 0.31
131 0.36
132 0.39
133 0.39
134 0.41