Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

K5X8Y9

Protein Details
Accession K5X8Y9    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
426-445KTFGIPSVRRYLRKRKPRVDBasic
NLS Segment(s)
PositionSequence
438-442RKRKP
Subcellular Location(s) plas 24, E.R. 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR004277  PSS  
Gene Ontology GO:0005789  C:endoplasmic reticulum membrane  
GO:0106245  F:L-serine-phosphatidylethanolamine phosphatidyltransferase activity  
GO:0006659  P:phosphatidylserine biosynthetic process  
KEGG abp:AGABI1DRAFT74777  -  
Pfam View protein in Pfam  
PF03034  PSS  
Amino Acid Sequences MKSNGEDSATSLGEESDGPISPVTEQGPSPGVDGTPVRWYDADRTEPYTRIIPFQERHDTSVEFFYNPLTLSALTCALILLAYVAMTQDVLEEGRDKRRVGVYAAIVAFLMFSMIQFRDGPFIRPHPAFWRAVLGVNLLYELGVVFLLFQDLQTARHMMTYIDPKLGVPLPEKSYAEDCSLTPQNIWNAIDVFCIAHTLGWFGKAMILRDYWFCWILSIAFELAEYSLQHQLANFAECWWDHWILDVLVCNWIGTYLGMKVCQYLEVKPYSWRGFRQTRGIRPKMKRVLSQFSPHDFTAFKWGTATDPLHYFTVVLLLFVFLAAELNPFYLKTLLWMEPDHPIIILRLTFVFLCALPAVRELYQYVNHPRRAVRMGQHCWLLLATIITEILVIAKWSKGMFSEPLPATVKWGWAAGAFVLIFYPIKTFGIPSVRRYLRKRKPRVD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.12
3 0.1
4 0.1
5 0.11
6 0.11
7 0.11
8 0.11
9 0.14
10 0.13
11 0.14
12 0.13
13 0.15
14 0.17
15 0.17
16 0.18
17 0.16
18 0.14
19 0.15
20 0.16
21 0.16
22 0.2
23 0.2
24 0.21
25 0.21
26 0.23
27 0.27
28 0.32
29 0.37
30 0.33
31 0.39
32 0.4
33 0.41
34 0.42
35 0.4
36 0.35
37 0.33
38 0.35
39 0.36
40 0.36
41 0.42
42 0.49
43 0.46
44 0.47
45 0.46
46 0.43
47 0.37
48 0.4
49 0.34
50 0.25
51 0.23
52 0.21
53 0.18
54 0.18
55 0.16
56 0.11
57 0.1
58 0.1
59 0.11
60 0.11
61 0.1
62 0.1
63 0.09
64 0.07
65 0.07
66 0.06
67 0.05
68 0.04
69 0.03
70 0.03
71 0.04
72 0.04
73 0.04
74 0.04
75 0.03
76 0.04
77 0.04
78 0.05
79 0.09
80 0.12
81 0.19
82 0.23
83 0.23
84 0.26
85 0.3
86 0.31
87 0.31
88 0.34
89 0.28
90 0.3
91 0.3
92 0.26
93 0.22
94 0.19
95 0.16
96 0.1
97 0.09
98 0.03
99 0.03
100 0.06
101 0.06
102 0.08
103 0.09
104 0.09
105 0.15
106 0.16
107 0.19
108 0.21
109 0.24
110 0.28
111 0.28
112 0.3
113 0.3
114 0.34
115 0.32
116 0.28
117 0.29
118 0.25
119 0.26
120 0.25
121 0.2
122 0.15
123 0.14
124 0.13
125 0.08
126 0.07
127 0.05
128 0.04
129 0.03
130 0.03
131 0.03
132 0.03
133 0.03
134 0.04
135 0.04
136 0.03
137 0.06
138 0.06
139 0.08
140 0.09
141 0.1
142 0.1
143 0.1
144 0.11
145 0.09
146 0.12
147 0.17
148 0.17
149 0.17
150 0.17
151 0.16
152 0.19
153 0.2
154 0.17
155 0.14
156 0.16
157 0.18
158 0.22
159 0.22
160 0.21
161 0.22
162 0.22
163 0.22
164 0.19
165 0.16
166 0.18
167 0.2
168 0.18
169 0.17
170 0.17
171 0.17
172 0.18
173 0.19
174 0.14
175 0.13
176 0.13
177 0.13
178 0.11
179 0.09
180 0.06
181 0.07
182 0.06
183 0.05
184 0.04
185 0.06
186 0.06
187 0.06
188 0.06
189 0.06
190 0.09
191 0.09
192 0.1
193 0.1
194 0.11
195 0.11
196 0.11
197 0.12
198 0.11
199 0.11
200 0.1
201 0.09
202 0.09
203 0.08
204 0.08
205 0.07
206 0.06
207 0.05
208 0.05
209 0.05
210 0.04
211 0.05
212 0.04
213 0.05
214 0.07
215 0.08
216 0.08
217 0.08
218 0.09
219 0.1
220 0.11
221 0.09
222 0.07
223 0.08
224 0.08
225 0.1
226 0.12
227 0.11
228 0.1
229 0.11
230 0.12
231 0.11
232 0.11
233 0.1
234 0.07
235 0.08
236 0.08
237 0.07
238 0.06
239 0.06
240 0.05
241 0.05
242 0.05
243 0.06
244 0.07
245 0.07
246 0.07
247 0.08
248 0.08
249 0.11
250 0.12
251 0.11
252 0.14
253 0.16
254 0.17
255 0.19
256 0.24
257 0.25
258 0.27
259 0.28
260 0.32
261 0.37
262 0.39
263 0.47
264 0.49
265 0.55
266 0.62
267 0.67
268 0.69
269 0.68
270 0.75
271 0.73
272 0.71
273 0.67
274 0.63
275 0.64
276 0.59
277 0.61
278 0.55
279 0.51
280 0.5
281 0.44
282 0.39
283 0.31
284 0.27
285 0.29
286 0.25
287 0.21
288 0.17
289 0.18
290 0.18
291 0.22
292 0.22
293 0.14
294 0.15
295 0.17
296 0.17
297 0.17
298 0.16
299 0.11
300 0.13
301 0.11
302 0.1
303 0.08
304 0.07
305 0.07
306 0.07
307 0.07
308 0.03
309 0.03
310 0.03
311 0.04
312 0.04
313 0.05
314 0.05
315 0.05
316 0.06
317 0.07
318 0.07
319 0.09
320 0.13
321 0.14
322 0.16
323 0.17
324 0.17
325 0.2
326 0.21
327 0.19
328 0.15
329 0.14
330 0.12
331 0.13
332 0.11
333 0.09
334 0.08
335 0.09
336 0.09
337 0.09
338 0.1
339 0.08
340 0.09
341 0.09
342 0.09
343 0.08
344 0.1
345 0.12
346 0.11
347 0.12
348 0.12
349 0.15
350 0.17
351 0.22
352 0.31
353 0.36
354 0.39
355 0.41
356 0.42
357 0.45
358 0.47
359 0.47
360 0.46
361 0.48
362 0.51
363 0.52
364 0.52
365 0.46
366 0.43
367 0.36
368 0.28
369 0.18
370 0.13
371 0.09
372 0.07
373 0.07
374 0.06
375 0.06
376 0.05
377 0.05
378 0.05
379 0.05
380 0.06
381 0.06
382 0.08
383 0.08
384 0.09
385 0.1
386 0.13
387 0.16
388 0.17
389 0.26
390 0.25
391 0.3
392 0.33
393 0.32
394 0.34
395 0.32
396 0.31
397 0.23
398 0.23
399 0.19
400 0.16
401 0.17
402 0.11
403 0.12
404 0.1
405 0.09
406 0.09
407 0.09
408 0.09
409 0.08
410 0.1
411 0.09
412 0.1
413 0.1
414 0.11
415 0.16
416 0.26
417 0.29
418 0.33
419 0.42
420 0.48
421 0.56
422 0.64
423 0.7
424 0.7
425 0.78