Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

K5X3C7

Protein Details
Accession K5X3C7    Localization Confidence Medium Confidence Score 12.9
NoLS Segment(s)
PositionSequenceProtein Nature
48-74GPGSKSERAKRIRENKQKIKDKNFMSTHydrophilic
NLS Segment(s)
PositionSequence
55-65RAKRIRENKQK
Subcellular Location(s) nucl 18, cyto_nucl 13, cyto 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR013870  Ribosomal_L37_mit  
Gene Ontology GO:0005739  C:mitochondrion  
GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
KEGG abp:AGABI1DRAFT35240  -  
Pfam View protein in Pfam  
PF08561  Ribosomal_L37  
Amino Acid Sequences PISSCVENTKIEGVNYLKSQAPVLALPDDQYPEWLWTVSQPKVYDDEGPGSKSERAKRIRENKQKIKDKNFMSTQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.24
2 0.24
3 0.24
4 0.21
5 0.2
6 0.2
7 0.16
8 0.16
9 0.12
10 0.13
11 0.13
12 0.11
13 0.11
14 0.12
15 0.12
16 0.11
17 0.12
18 0.1
19 0.1
20 0.1
21 0.09
22 0.08
23 0.11
24 0.15
25 0.15
26 0.17
27 0.17
28 0.17
29 0.2
30 0.21
31 0.19
32 0.16
33 0.2
34 0.18
35 0.19
36 0.18
37 0.18
38 0.2
39 0.24
40 0.29
41 0.33
42 0.39
43 0.45
44 0.54
45 0.63
46 0.71
47 0.76
48 0.82
49 0.84
50 0.88
51 0.91
52 0.91
53 0.89
54 0.87
55 0.81