Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

K5X524

Protein Details
Accession K5X524    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
79-100RGYRKGIHKVPKWTRVRRLCVFHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 22, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR016340  Ribosomal_L31_mit  
KEGG abp:AGABI1DRAFT125445  -  
Pfam View protein in Pfam  
PF09784  L31  
Amino Acid Sequences MLFKASRVNLSGLLWKTPWKLSVTRKANARARLKKVDAVIEAVRASGVQCKSLDRALELPKEHEMPAKDKYTIFSPHERGYRKGIHKVPKWTRVRRLCVFPWTQLTLVR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.24
2 0.25
3 0.26
4 0.26
5 0.27
6 0.24
7 0.3
8 0.36
9 0.46
10 0.49
11 0.51
12 0.55
13 0.61
14 0.64
15 0.66
16 0.68
17 0.66
18 0.67
19 0.7
20 0.66
21 0.61
22 0.56
23 0.51
24 0.41
25 0.36
26 0.29
27 0.23
28 0.2
29 0.16
30 0.14
31 0.1
32 0.09
33 0.11
34 0.1
35 0.11
36 0.11
37 0.12
38 0.14
39 0.16
40 0.15
41 0.11
42 0.15
43 0.17
44 0.2
45 0.19
46 0.2
47 0.2
48 0.21
49 0.2
50 0.2
51 0.18
52 0.18
53 0.22
54 0.23
55 0.22
56 0.21
57 0.23
58 0.24
59 0.27
60 0.28
61 0.3
62 0.32
63 0.36
64 0.42
65 0.43
66 0.42
67 0.43
68 0.48
69 0.47
70 0.52
71 0.54
72 0.58
73 0.61
74 0.7
75 0.72
76 0.74
77 0.78
78 0.78
79 0.81
80 0.81
81 0.83
82 0.79
83 0.78
84 0.72
85 0.71
86 0.66
87 0.61
88 0.57
89 0.52