Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

K5XE97

Protein Details
Accession K5XE97    Localization Confidence Medium Confidence Score 14.5
NoLS Segment(s)
PositionSequenceProtein Nature
343-363YYKNIERKMLLKKKRANQYEQHydrophilic
NLS Segment(s)
PositionSequence
337-342RRGKGA
345-357KNIERKMLLKKKR
Subcellular Location(s) nucl 15.5, cyto_nucl 9.5, mito 7, cyto 2.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR007133  RNA_pol_II-assoc_Paf1  
Gene Ontology GO:0016593  C:Cdc73/Paf1 complex  
GO:0016570  P:histone modification  
GO:0006368  P:transcription elongation by RNA polymerase II  
KEGG abp:AGABI1DRAFT105180  -  
Pfam View protein in Pfam  
PF03985  Paf1  
Amino Acid Sequences MSFKKSSKLDLLVRVRYSNPVPAPPFPPKLLDIPTNPRRYTRPEFLNELVNETPLPMIVDAELGMPLELGNWESLWEEGADDSGTWNKALNPDPSNLPKLDPKDAFLLSDPSTSTGITANVGSGSGASAPLAHVPWLRKTEYISREGISRTSSQDLSKHNINSAPIDISRNAQLRDIEASFTASNDTFDLSKLKHPNKPDITAVDSYPILPDADIWPNQYDLFRFSERPGDRAVDVEDERLDCAILRPMKTEHDSFLAYYLTHDDESALRLKETRAGVGPYEVPENQEPTWFQFVRDYETIKVEQNIDNELLLVLWDGEEPESFEDLMSRVDKQPPRRGKGAYYKNIERKMLLKKKRANQYEQYDDKWEVIRMTHAPISEEEETERQDYLAEVSDPDYLLKMRTDADAEGEIEVDDSIYMNGGSGHGIKTEGI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.58
2 0.53
3 0.51
4 0.47
5 0.45
6 0.4
7 0.41
8 0.42
9 0.44
10 0.49
11 0.51
12 0.53
13 0.47
14 0.47
15 0.41
16 0.42
17 0.43
18 0.42
19 0.41
20 0.47
21 0.54
22 0.59
23 0.57
24 0.56
25 0.56
26 0.59
27 0.61
28 0.6
29 0.59
30 0.57
31 0.62
32 0.6
33 0.64
34 0.55
35 0.52
36 0.43
37 0.35
38 0.29
39 0.23
40 0.2
41 0.12
42 0.13
43 0.07
44 0.07
45 0.07
46 0.07
47 0.07
48 0.07
49 0.07
50 0.06
51 0.06
52 0.05
53 0.05
54 0.05
55 0.05
56 0.05
57 0.05
58 0.05
59 0.06
60 0.07
61 0.07
62 0.07
63 0.07
64 0.06
65 0.06
66 0.07
67 0.07
68 0.06
69 0.07
70 0.1
71 0.1
72 0.1
73 0.11
74 0.12
75 0.17
76 0.21
77 0.26
78 0.26
79 0.28
80 0.33
81 0.37
82 0.39
83 0.35
84 0.33
85 0.33
86 0.34
87 0.4
88 0.35
89 0.33
90 0.33
91 0.33
92 0.32
93 0.27
94 0.27
95 0.2
96 0.2
97 0.18
98 0.16
99 0.16
100 0.14
101 0.14
102 0.11
103 0.1
104 0.1
105 0.1
106 0.08
107 0.07
108 0.07
109 0.06
110 0.05
111 0.05
112 0.04
113 0.04
114 0.04
115 0.04
116 0.04
117 0.06
118 0.06
119 0.07
120 0.1
121 0.12
122 0.17
123 0.2
124 0.21
125 0.21
126 0.24
127 0.32
128 0.33
129 0.35
130 0.32
131 0.29
132 0.31
133 0.31
134 0.29
135 0.22
136 0.2
137 0.19
138 0.2
139 0.21
140 0.19
141 0.23
142 0.26
143 0.28
144 0.31
145 0.29
146 0.28
147 0.28
148 0.28
149 0.24
150 0.22
151 0.19
152 0.15
153 0.16
154 0.15
155 0.14
156 0.18
157 0.2
158 0.19
159 0.19
160 0.19
161 0.18
162 0.2
163 0.19
164 0.15
165 0.12
166 0.14
167 0.12
168 0.11
169 0.12
170 0.09
171 0.08
172 0.08
173 0.09
174 0.07
175 0.07
176 0.09
177 0.09
178 0.15
179 0.23
180 0.27
181 0.31
182 0.33
183 0.42
184 0.44
185 0.46
186 0.42
187 0.36
188 0.36
189 0.33
190 0.3
191 0.22
192 0.18
193 0.15
194 0.13
195 0.11
196 0.07
197 0.06
198 0.06
199 0.07
200 0.09
201 0.1
202 0.11
203 0.11
204 0.11
205 0.12
206 0.12
207 0.1
208 0.1
209 0.13
210 0.13
211 0.14
212 0.14
213 0.23
214 0.23
215 0.24
216 0.23
217 0.21
218 0.19
219 0.19
220 0.19
221 0.14
222 0.14
223 0.13
224 0.12
225 0.11
226 0.11
227 0.1
228 0.09
229 0.05
230 0.06
231 0.1
232 0.12
233 0.13
234 0.14
235 0.16
236 0.19
237 0.22
238 0.22
239 0.18
240 0.19
241 0.19
242 0.17
243 0.17
244 0.14
245 0.11
246 0.1
247 0.11
248 0.09
249 0.09
250 0.09
251 0.08
252 0.08
253 0.1
254 0.13
255 0.12
256 0.11
257 0.12
258 0.12
259 0.17
260 0.17
261 0.17
262 0.15
263 0.16
264 0.16
265 0.17
266 0.18
267 0.14
268 0.16
269 0.14
270 0.15
271 0.15
272 0.17
273 0.16
274 0.17
275 0.16
276 0.18
277 0.25
278 0.22
279 0.22
280 0.24
281 0.24
282 0.29
283 0.3
284 0.28
285 0.22
286 0.25
287 0.26
288 0.23
289 0.24
290 0.21
291 0.22
292 0.21
293 0.21
294 0.18
295 0.17
296 0.15
297 0.13
298 0.1
299 0.07
300 0.06
301 0.04
302 0.04
303 0.04
304 0.04
305 0.04
306 0.05
307 0.06
308 0.07
309 0.08
310 0.08
311 0.08
312 0.08
313 0.08
314 0.11
315 0.11
316 0.12
317 0.14
318 0.23
319 0.28
320 0.36
321 0.46
322 0.53
323 0.57
324 0.61
325 0.6
326 0.61
327 0.66
328 0.68
329 0.67
330 0.65
331 0.69
332 0.72
333 0.75
334 0.67
335 0.58
336 0.55
337 0.57
338 0.59
339 0.59
340 0.61
341 0.64
342 0.72
343 0.8
344 0.81
345 0.78
346 0.78
347 0.78
348 0.78
349 0.74
350 0.68
351 0.62
352 0.56
353 0.49
354 0.42
355 0.34
356 0.25
357 0.21
358 0.22
359 0.2
360 0.23
361 0.23
362 0.22
363 0.22
364 0.22
365 0.27
366 0.25
367 0.24
368 0.22
369 0.22
370 0.24
371 0.24
372 0.23
373 0.16
374 0.15
375 0.15
376 0.13
377 0.14
378 0.12
379 0.11
380 0.13
381 0.14
382 0.14
383 0.14
384 0.14
385 0.11
386 0.13
387 0.13
388 0.13
389 0.13
390 0.15
391 0.16
392 0.15
393 0.18
394 0.18
395 0.18
396 0.17
397 0.16
398 0.14
399 0.12
400 0.11
401 0.08
402 0.06
403 0.05
404 0.05
405 0.06
406 0.05
407 0.05
408 0.06
409 0.06
410 0.08
411 0.09
412 0.1
413 0.1