Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

K5X3S6

Protein Details
Accession K5X3S6   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
15-37AFLARFPLKKHPRIPLPPNEYRPHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 18, cyto 4, extr 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR033468  Metaxin_GST  
KEGG abp:AGABI1DRAFT111105  -  
Pfam View protein in Pfam  
PF17171  GST_C_6  
Amino Acid Sequences MSSSAAPRLPAPLAAFLARFPLKKHPRIPLPPNEYRPVKSSTLWLSPPLDGTDLLSADVECLKWQAYIALRGLKDIRVRFDVSPEGALEGRLPNIHVPLSESVLPKDDTEKDGDLLASQMIPTWVDARLGVDSSADENEGYLDESAKDESRAWVSLLEGTVHAALILSQPKPAYWYTLLFPPTKAEHRPVASLLTPPPAPLTGYLSLLPPWGTRISHSAIMAQYRDAIASLSERLGTDKWFLGSAEPTPLDALAFAYLHCILHSSDAVRIEVTKRVNLVAWEWRVRGVIRGAFIQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.22
3 0.18
4 0.24
5 0.24
6 0.23
7 0.23
8 0.32
9 0.4
10 0.48
11 0.55
12 0.58
13 0.65
14 0.74
15 0.8
16 0.8
17 0.8
18 0.8
19 0.79
20 0.78
21 0.72
22 0.65
23 0.6
24 0.54
25 0.48
26 0.4
27 0.4
28 0.37
29 0.39
30 0.37
31 0.37
32 0.34
33 0.31
34 0.32
35 0.27
36 0.22
37 0.17
38 0.17
39 0.15
40 0.13
41 0.13
42 0.11
43 0.1
44 0.09
45 0.1
46 0.08
47 0.07
48 0.07
49 0.07
50 0.07
51 0.07
52 0.1
53 0.12
54 0.16
55 0.18
56 0.23
57 0.22
58 0.24
59 0.26
60 0.25
61 0.29
62 0.27
63 0.29
64 0.27
65 0.3
66 0.28
67 0.3
68 0.3
69 0.25
70 0.24
71 0.2
72 0.18
73 0.15
74 0.15
75 0.12
76 0.1
77 0.09
78 0.09
79 0.09
80 0.08
81 0.1
82 0.1
83 0.09
84 0.11
85 0.11
86 0.13
87 0.16
88 0.16
89 0.15
90 0.17
91 0.18
92 0.16
93 0.18
94 0.17
95 0.15
96 0.17
97 0.18
98 0.16
99 0.15
100 0.15
101 0.12
102 0.1
103 0.09
104 0.06
105 0.05
106 0.04
107 0.04
108 0.04
109 0.05
110 0.05
111 0.06
112 0.06
113 0.06
114 0.07
115 0.07
116 0.07
117 0.07
118 0.06
119 0.06
120 0.06
121 0.06
122 0.06
123 0.05
124 0.05
125 0.05
126 0.05
127 0.05
128 0.04
129 0.04
130 0.04
131 0.05
132 0.06
133 0.06
134 0.07
135 0.07
136 0.08
137 0.09
138 0.09
139 0.09
140 0.08
141 0.08
142 0.09
143 0.09
144 0.08
145 0.07
146 0.07
147 0.06
148 0.06
149 0.05
150 0.04
151 0.04
152 0.05
153 0.08
154 0.07
155 0.08
156 0.09
157 0.09
158 0.11
159 0.11
160 0.13
161 0.12
162 0.14
163 0.14
164 0.19
165 0.22
166 0.2
167 0.2
168 0.19
169 0.21
170 0.23
171 0.24
172 0.23
173 0.26
174 0.27
175 0.28
176 0.26
177 0.25
178 0.23
179 0.22
180 0.2
181 0.18
182 0.16
183 0.15
184 0.15
185 0.12
186 0.12
187 0.11
188 0.15
189 0.13
190 0.14
191 0.15
192 0.14
193 0.14
194 0.14
195 0.14
196 0.09
197 0.1
198 0.11
199 0.11
200 0.12
201 0.15
202 0.18
203 0.2
204 0.21
205 0.21
206 0.21
207 0.23
208 0.22
209 0.19
210 0.16
211 0.13
212 0.13
213 0.1
214 0.09
215 0.07
216 0.08
217 0.09
218 0.08
219 0.09
220 0.09
221 0.11
222 0.12
223 0.13
224 0.13
225 0.14
226 0.14
227 0.14
228 0.14
229 0.14
230 0.16
231 0.15
232 0.18
233 0.16
234 0.16
235 0.16
236 0.15
237 0.13
238 0.11
239 0.11
240 0.07
241 0.07
242 0.07
243 0.09
244 0.1
245 0.1
246 0.09
247 0.1
248 0.09
249 0.12
250 0.14
251 0.12
252 0.15
253 0.17
254 0.18
255 0.17
256 0.19
257 0.18
258 0.22
259 0.24
260 0.23
261 0.22
262 0.23
263 0.25
264 0.24
265 0.26
266 0.29
267 0.33
268 0.35
269 0.34
270 0.34
271 0.35
272 0.34
273 0.34
274 0.31
275 0.28