Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

K5XY45

Protein Details
Accession K5XY45   
Localization Confidence Low
Confidence Score 7.1
NoLS Segment(s)
PositionSequenceProtein Nature
246-273TPIPPHCKAKKEEEKKRQQRADAEKAASHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto_nucl 7, nucl 6.5, cyto 6.5, plas 6, pero 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR001199  Cyt_B5-like_heme/steroid-bd  
IPR036400  Cyt_B5-like_heme/steroid_sf  
Gene Ontology GO:0016020  C:membrane  
KEGG abp:AGABI1DRAFT113450  -  
Pfam View protein in Pfam  
PF00173  Cyt-b5  
Amino Acid Sequences MSWLKEMAGGEKMPPYVENDSSSPKVKDPYIPNRMVSNKPANRPFLAYRDYREKQEALHAEWLKKKEEHDEKVARGEKVEPLEPDPTAVHEVGVLGLLKFILYLVLIIALAGKFITGSFVWEYESQWLQLRTYMPKSDRLFSERMLAQYDGSDPNKPIYLAIGGVVYDVTKSSAYRPGGSYHVFAGADASRAFATTCLDQDHATHDLRGLSAAELESMQNWKVFYRDHKDYFRVGRVTHKPVDPSTPIPPHCKAKKEEEKKRQQRADAEKAASEQDRGEHDEL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.19
2 0.21
3 0.22
4 0.24
5 0.26
6 0.25
7 0.32
8 0.35
9 0.38
10 0.35
11 0.33
12 0.35
13 0.34
14 0.39
15 0.42
16 0.5
17 0.54
18 0.56
19 0.55
20 0.58
21 0.61
22 0.57
23 0.55
24 0.55
25 0.53
26 0.58
27 0.62
28 0.59
29 0.56
30 0.57
31 0.53
32 0.48
33 0.47
34 0.41
35 0.4
36 0.46
37 0.46
38 0.45
39 0.46
40 0.4
41 0.36
42 0.43
43 0.41
44 0.34
45 0.41
46 0.4
47 0.4
48 0.45
49 0.46
50 0.41
51 0.4
52 0.38
53 0.39
54 0.45
55 0.45
56 0.49
57 0.53
58 0.51
59 0.58
60 0.6
61 0.5
62 0.42
63 0.39
64 0.33
65 0.3
66 0.31
67 0.24
68 0.22
69 0.24
70 0.22
71 0.22
72 0.18
73 0.16
74 0.16
75 0.15
76 0.12
77 0.1
78 0.1
79 0.08
80 0.09
81 0.07
82 0.04
83 0.04
84 0.04
85 0.04
86 0.04
87 0.03
88 0.03
89 0.02
90 0.03
91 0.02
92 0.03
93 0.03
94 0.03
95 0.03
96 0.03
97 0.03
98 0.03
99 0.03
100 0.03
101 0.03
102 0.05
103 0.04
104 0.06
105 0.07
106 0.07
107 0.09
108 0.09
109 0.1
110 0.11
111 0.12
112 0.11
113 0.13
114 0.13
115 0.12
116 0.14
117 0.15
118 0.16
119 0.18
120 0.22
121 0.2
122 0.28
123 0.3
124 0.3
125 0.3
126 0.3
127 0.29
128 0.26
129 0.29
130 0.22
131 0.21
132 0.21
133 0.19
134 0.15
135 0.14
136 0.15
137 0.13
138 0.13
139 0.14
140 0.12
141 0.13
142 0.13
143 0.13
144 0.11
145 0.09
146 0.08
147 0.07
148 0.07
149 0.06
150 0.05
151 0.05
152 0.05
153 0.04
154 0.03
155 0.04
156 0.04
157 0.04
158 0.05
159 0.07
160 0.13
161 0.15
162 0.17
163 0.18
164 0.19
165 0.22
166 0.23
167 0.22
168 0.17
169 0.18
170 0.16
171 0.14
172 0.14
173 0.11
174 0.11
175 0.1
176 0.1
177 0.08
178 0.08
179 0.08
180 0.07
181 0.09
182 0.08
183 0.09
184 0.1
185 0.11
186 0.11
187 0.12
188 0.15
189 0.16
190 0.16
191 0.15
192 0.15
193 0.14
194 0.14
195 0.14
196 0.11
197 0.08
198 0.08
199 0.08
200 0.07
201 0.07
202 0.07
203 0.08
204 0.09
205 0.09
206 0.1
207 0.1
208 0.1
209 0.11
210 0.15
211 0.21
212 0.28
213 0.36
214 0.41
215 0.46
216 0.49
217 0.54
218 0.57
219 0.56
220 0.51
221 0.44
222 0.47
223 0.49
224 0.53
225 0.52
226 0.49
227 0.46
228 0.45
229 0.5
230 0.45
231 0.41
232 0.43
233 0.45
234 0.46
235 0.48
236 0.51
237 0.55
238 0.57
239 0.6
240 0.57
241 0.6
242 0.68
243 0.73
244 0.79
245 0.8
246 0.85
247 0.88
248 0.94
249 0.91
250 0.87
251 0.86
252 0.84
253 0.84
254 0.8
255 0.72
256 0.63
257 0.57
258 0.55
259 0.46
260 0.37
261 0.28
262 0.23
263 0.24