Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

K5X5N9

Protein Details
Accession K5X5N9    Localization Confidence Medium Confidence Score 13.6
NoLS Segment(s)
PositionSequenceProtein Nature
30-52LEKERIERDRERRERRKKEEEGEBasic
NLS Segment(s)
PositionSequence
11-47REREAKIREQRKLEEKEVLLEKERIERDRERRERRKK
Subcellular Location(s) nucl 20.5, cyto_nucl 12.5, cyto 3.5
Family & Domain DBs
KEGG abp:AGABI1DRAFT114586  -  
Amino Acid Sequences MRYRREKEEQREREAKIREQRKLEEKEVLLEKERIERDRERRERRKKEEEGEWVCLDLGNDFGFWIVFENCTSTLSASDEI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.69
2 0.67
3 0.65
4 0.66
5 0.63
6 0.62
7 0.65
8 0.66
9 0.67
10 0.61
11 0.58
12 0.49
13 0.48
14 0.46
15 0.41
16 0.34
17 0.29
18 0.27
19 0.27
20 0.28
21 0.25
22 0.25
23 0.31
24 0.37
25 0.46
26 0.55
27 0.6
28 0.68
29 0.77
30 0.83
31 0.86
32 0.87
33 0.83
34 0.79
35 0.76
36 0.75
37 0.69
38 0.63
39 0.54
40 0.44
41 0.38
42 0.32
43 0.24
44 0.15
45 0.11
46 0.06
47 0.06
48 0.05
49 0.06
50 0.05
51 0.05
52 0.08
53 0.07
54 0.08
55 0.08
56 0.11
57 0.11
58 0.13
59 0.13
60 0.11
61 0.12