Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

K5Y1E7

Protein Details
Accession K5Y1E7   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
15-38TYDSEKKYRSHKSSSKPRPLPSVFHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto 18, cyto_mito 13.333, cyto_nucl 9.833, mito 7.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR035518  DPG_synthase  
IPR001173  Glyco_trans_2-like  
IPR029044  Nucleotide-diphossugar_trans  
Gene Ontology GO:0004581  F:dolichyl-phosphate beta-glucosyltransferase activity  
KEGG abp:AGABI1DRAFT35803  -  
Pfam View protein in Pfam  
PF00535  Glycos_transf_2  
CDD cd04188  DPG_synthase  
Amino Acid Sequences LYLALIYWSPPPIITYDSEKKYRSHKSSSKPRPLPSVFDPATTDLSVVVPAFNEKDRLPLMLEETITHLESLSKKRSYEILIVDDGSSDGTSQTALELAGKYPKSDIRVITFEKNLGKGGAVRHGMLYGGGERLLMVDADGASKFSDLEKLWKAMDEIAPNKKAGVAVGSRAHLVNSEAVVKRSLLRNILMYGLHTLLRIVGVGHIRDTQCGFKLFSRSAAKQIFPAQHLSTWIFDVELLLLAKQLQIPVAEVPVDWHEVAGSKLHVVAASLQMLRDLLIVRANLLTGRWKATPVKSKLE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.24
3 0.31
4 0.37
5 0.43
6 0.44
7 0.46
8 0.53
9 0.6
10 0.58
11 0.6
12 0.63
13 0.68
14 0.78
15 0.85
16 0.87
17 0.84
18 0.82
19 0.82
20 0.76
21 0.72
22 0.66
23 0.65
24 0.54
25 0.48
26 0.46
27 0.38
28 0.38
29 0.31
30 0.26
31 0.16
32 0.15
33 0.14
34 0.12
35 0.09
36 0.06
37 0.08
38 0.1
39 0.1
40 0.13
41 0.12
42 0.16
43 0.17
44 0.18
45 0.18
46 0.17
47 0.2
48 0.19
49 0.2
50 0.16
51 0.18
52 0.18
53 0.17
54 0.15
55 0.12
56 0.13
57 0.17
58 0.23
59 0.27
60 0.28
61 0.28
62 0.29
63 0.33
64 0.33
65 0.34
66 0.32
67 0.28
68 0.27
69 0.27
70 0.25
71 0.22
72 0.18
73 0.13
74 0.09
75 0.06
76 0.05
77 0.04
78 0.04
79 0.04
80 0.04
81 0.04
82 0.04
83 0.05
84 0.06
85 0.07
86 0.12
87 0.12
88 0.12
89 0.14
90 0.16
91 0.18
92 0.21
93 0.22
94 0.21
95 0.26
96 0.29
97 0.31
98 0.29
99 0.29
100 0.27
101 0.26
102 0.22
103 0.18
104 0.15
105 0.13
106 0.14
107 0.16
108 0.16
109 0.15
110 0.14
111 0.14
112 0.14
113 0.12
114 0.11
115 0.06
116 0.05
117 0.05
118 0.05
119 0.04
120 0.05
121 0.05
122 0.04
123 0.03
124 0.03
125 0.03
126 0.04
127 0.04
128 0.04
129 0.04
130 0.04
131 0.05
132 0.05
133 0.08
134 0.07
135 0.12
136 0.13
137 0.14
138 0.14
139 0.14
140 0.14
141 0.13
142 0.15
143 0.14
144 0.17
145 0.2
146 0.22
147 0.21
148 0.21
149 0.19
150 0.17
151 0.14
152 0.13
153 0.09
154 0.11
155 0.13
156 0.13
157 0.13
158 0.13
159 0.13
160 0.11
161 0.11
162 0.08
163 0.07
164 0.11
165 0.12
166 0.12
167 0.13
168 0.13
169 0.14
170 0.17
171 0.18
172 0.16
173 0.16
174 0.17
175 0.17
176 0.18
177 0.16
178 0.13
179 0.12
180 0.11
181 0.11
182 0.09
183 0.08
184 0.07
185 0.07
186 0.06
187 0.05
188 0.07
189 0.08
190 0.09
191 0.1
192 0.14
193 0.14
194 0.15
195 0.17
196 0.16
197 0.17
198 0.18
199 0.19
200 0.18
201 0.23
202 0.22
203 0.28
204 0.33
205 0.32
206 0.38
207 0.4
208 0.37
209 0.36
210 0.41
211 0.37
212 0.32
213 0.35
214 0.29
215 0.26
216 0.29
217 0.27
218 0.22
219 0.19
220 0.17
221 0.13
222 0.11
223 0.11
224 0.08
225 0.08
226 0.08
227 0.07
228 0.07
229 0.07
230 0.08
231 0.08
232 0.08
233 0.07
234 0.07
235 0.09
236 0.1
237 0.11
238 0.1
239 0.09
240 0.11
241 0.12
242 0.14
243 0.12
244 0.11
245 0.11
246 0.11
247 0.12
248 0.12
249 0.11
250 0.09
251 0.1
252 0.1
253 0.1
254 0.1
255 0.11
256 0.12
257 0.14
258 0.14
259 0.14
260 0.14
261 0.14
262 0.13
263 0.13
264 0.11
265 0.09
266 0.12
267 0.12
268 0.13
269 0.13
270 0.13
271 0.12
272 0.13
273 0.18
274 0.17
275 0.21
276 0.21
277 0.25
278 0.31
279 0.4
280 0.49