Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

K5XK88

Protein Details
Accession K5XK88   
Localization Confidence Low
Confidence Score 8.8
NoLS Segment(s)
PositionSequenceProtein Nature
127-147TKNVKSKGKGKGKQKLTKLNLHydrophilic
NLS Segment(s)
PositionSequence
131-140KSKGKGKGKQ
Subcellular Location(s) cyto 20, cyto_nucl 12.5, nucl 3, mito 3
Family & Domain DBs
KEGG abp:AGABI1DRAFT116674  -  
Amino Acid Sequences MSITKTIPLTPSPIIPVTDEQIKVLPGIPAAQQAKINIYNELLEEVYIRRTELEGLDDHLAAMKREIEDDIAYLAFKHAEEASLKAAKLNKIEKDGSVSPKSNANPNAAANVISAAIANLKYVAGTTKNVKSKGKGKGKQKLTKLNLDDDHYGYSGDDDYEYAEDEESEEDGEVSLIPTSFN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.24
2 0.24
3 0.25
4 0.23
5 0.27
6 0.26
7 0.23
8 0.22
9 0.21
10 0.19
11 0.18
12 0.15
13 0.1
14 0.11
15 0.11
16 0.17
17 0.18
18 0.19
19 0.2
20 0.2
21 0.24
22 0.26
23 0.27
24 0.2
25 0.2
26 0.18
27 0.17
28 0.18
29 0.13
30 0.09
31 0.09
32 0.09
33 0.1
34 0.1
35 0.09
36 0.09
37 0.09
38 0.1
39 0.1
40 0.12
41 0.1
42 0.12
43 0.13
44 0.13
45 0.12
46 0.13
47 0.13
48 0.11
49 0.11
50 0.1
51 0.09
52 0.1
53 0.1
54 0.09
55 0.08
56 0.08
57 0.08
58 0.07
59 0.07
60 0.06
61 0.06
62 0.05
63 0.05
64 0.06
65 0.05
66 0.06
67 0.07
68 0.08
69 0.11
70 0.12
71 0.12
72 0.13
73 0.16
74 0.16
75 0.2
76 0.23
77 0.22
78 0.24
79 0.25
80 0.23
81 0.26
82 0.27
83 0.28
84 0.28
85 0.27
86 0.24
87 0.28
88 0.29
89 0.29
90 0.29
91 0.26
92 0.24
93 0.23
94 0.24
95 0.19
96 0.19
97 0.13
98 0.11
99 0.08
100 0.06
101 0.06
102 0.04
103 0.05
104 0.05
105 0.04
106 0.04
107 0.04
108 0.04
109 0.04
110 0.06
111 0.07
112 0.09
113 0.14
114 0.21
115 0.27
116 0.31
117 0.34
118 0.38
119 0.44
120 0.52
121 0.58
122 0.59
123 0.63
124 0.69
125 0.77
126 0.8
127 0.8
128 0.8
129 0.75
130 0.77
131 0.7
132 0.68
133 0.61
134 0.57
135 0.52
136 0.42
137 0.39
138 0.3
139 0.27
140 0.19
141 0.16
142 0.13
143 0.1
144 0.09
145 0.07
146 0.08
147 0.08
148 0.1
149 0.09
150 0.09
151 0.08
152 0.09
153 0.1
154 0.09
155 0.09
156 0.07
157 0.07
158 0.07
159 0.07
160 0.07
161 0.06
162 0.07