Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

K5WT49

Protein Details
Accession K5WT49    Localization Confidence Medium Confidence Score 13.5
NoLS Segment(s)
PositionSequenceProtein Nature
44-65IIYGPKRSRGRPKGSSSKQTKAHydrophilic
NLS Segment(s)
PositionSequence
34-64RSRGRPRTKPIIYGPKRSRGRPKGSSSKQTK
Subcellular Location(s) nucl 21, cyto_nucl 13.5, cyto 4
Family & Domain DBs
KEGG abp:AGABI1DRAFT96110  -  
Amino Acid Sequences PSPPPPLNYEDNWASRPLSLPAAAVSYPDNNAQRSRGRPRTKPIIYGPKRSRGRPKGSSSKQTKARSSQNVGVSRSQASNRGKVNLVIRDKPIIGPGTSKPGDVVRPLVASPTSQAPEAQALEEDAQSTSLPANPPVETHSVIQEEDPECDIVDLVAADEDTDADGQGIGAEEDDIDELDNDGEDMRDGGGKFRYRRPLPPWLLDAFNSRVEDSKRRDAQGLPSLFQFHVLDYRLSVLLYQSSKRDVKGVVRVDAHMFPKRNRLQAILGLT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.34
2 0.29
3 0.29
4 0.25
5 0.22
6 0.19
7 0.17
8 0.16
9 0.18
10 0.17
11 0.16
12 0.15
13 0.14
14 0.15
15 0.2
16 0.22
17 0.22
18 0.24
19 0.28
20 0.33
21 0.4
22 0.49
23 0.54
24 0.6
25 0.65
26 0.71
27 0.77
28 0.74
29 0.73
30 0.72
31 0.73
32 0.71
33 0.74
34 0.71
35 0.71
36 0.72
37 0.73
38 0.74
39 0.72
40 0.76
41 0.74
42 0.77
43 0.78
44 0.81
45 0.84
46 0.8
47 0.79
48 0.79
49 0.78
50 0.75
51 0.71
52 0.72
53 0.7
54 0.69
55 0.67
56 0.65
57 0.63
58 0.6
59 0.54
60 0.46
61 0.4
62 0.36
63 0.31
64 0.31
65 0.29
66 0.32
67 0.32
68 0.33
69 0.32
70 0.33
71 0.37
72 0.37
73 0.38
74 0.35
75 0.34
76 0.34
77 0.33
78 0.3
79 0.28
80 0.21
81 0.17
82 0.17
83 0.16
84 0.22
85 0.22
86 0.21
87 0.19
88 0.19
89 0.2
90 0.18
91 0.19
92 0.12
93 0.13
94 0.13
95 0.13
96 0.12
97 0.1
98 0.1
99 0.11
100 0.11
101 0.1
102 0.1
103 0.1
104 0.12
105 0.12
106 0.11
107 0.08
108 0.08
109 0.08
110 0.08
111 0.08
112 0.06
113 0.06
114 0.06
115 0.06
116 0.05
117 0.06
118 0.07
119 0.07
120 0.09
121 0.08
122 0.09
123 0.11
124 0.13
125 0.13
126 0.13
127 0.14
128 0.13
129 0.13
130 0.13
131 0.14
132 0.13
133 0.12
134 0.12
135 0.1
136 0.09
137 0.09
138 0.09
139 0.05
140 0.05
141 0.04
142 0.03
143 0.03
144 0.03
145 0.03
146 0.03
147 0.03
148 0.03
149 0.03
150 0.03
151 0.03
152 0.03
153 0.03
154 0.03
155 0.03
156 0.03
157 0.03
158 0.03
159 0.03
160 0.03
161 0.03
162 0.03
163 0.03
164 0.03
165 0.04
166 0.04
167 0.04
168 0.04
169 0.04
170 0.04
171 0.04
172 0.04
173 0.04
174 0.06
175 0.07
176 0.09
177 0.14
178 0.2
179 0.23
180 0.3
181 0.39
182 0.4
183 0.48
184 0.52
185 0.57
186 0.58
187 0.59
188 0.56
189 0.49
190 0.47
191 0.41
192 0.39
193 0.31
194 0.29
195 0.26
196 0.22
197 0.24
198 0.26
199 0.33
200 0.35
201 0.42
202 0.44
203 0.45
204 0.47
205 0.46
206 0.5
207 0.51
208 0.47
209 0.38
210 0.35
211 0.36
212 0.32
213 0.33
214 0.25
215 0.17
216 0.18
217 0.19
218 0.18
219 0.15
220 0.18
221 0.15
222 0.15
223 0.14
224 0.11
225 0.14
226 0.17
227 0.19
228 0.19
229 0.25
230 0.28
231 0.28
232 0.31
233 0.29
234 0.33
235 0.4
236 0.43
237 0.42
238 0.42
239 0.43
240 0.44
241 0.45
242 0.43
243 0.42
244 0.42
245 0.39
246 0.48
247 0.52
248 0.55
249 0.53
250 0.52
251 0.49