Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

K5VP44

Protein Details
Accession K5VP44    Localization Confidence Medium Confidence Score 13.9
NoLS Segment(s)
PositionSequenceProtein Nature
5-30AEKVEKASSRKSKKDPKAPKRALSAYHydrophilic
NLS Segment(s)
PositionSequence
6-25EKVEKASSRKSKKDPKAPKR
Subcellular Location(s) nucl 22.5, cyto_nucl 13, cyto 2.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR009071  HMG_box_dom  
IPR036910  HMG_box_dom_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
KEGG abp:AGABI1DRAFT16670  -  
Pfam View protein in Pfam  
PF00505  HMG_box  
PROSITE View protein in PROSITE  
PS50118  HMG_BOX_2  
CDD cd01390  HMG-box_NHP6-like  
Amino Acid Sequences QRKAAEKVEKASSRKSKKDPKAPKRALSAYMFFSQDWRERIKTENPEAGFGEVGKLLGAKWKEMDEEEKKPYVEQATADKTRAEKEKASYDSGKKSASGDDEEEDE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.69
2 0.74
3 0.75
4 0.78
5 0.86
6 0.87
7 0.87
8 0.9
9 0.89
10 0.85
11 0.83
12 0.76
13 0.7
14 0.63
15 0.55
16 0.47
17 0.42
18 0.36
19 0.28
20 0.26
21 0.23
22 0.23
23 0.23
24 0.23
25 0.22
26 0.22
27 0.26
28 0.32
29 0.36
30 0.36
31 0.39
32 0.35
33 0.36
34 0.35
35 0.31
36 0.24
37 0.17
38 0.13
39 0.07
40 0.07
41 0.05
42 0.04
43 0.03
44 0.08
45 0.08
46 0.08
47 0.09
48 0.09
49 0.1
50 0.12
51 0.19
52 0.2
53 0.25
54 0.28
55 0.29
56 0.29
57 0.28
58 0.29
59 0.24
60 0.2
61 0.17
62 0.2
63 0.26
64 0.27
65 0.28
66 0.27
67 0.26
68 0.3
69 0.34
70 0.32
71 0.28
72 0.31
73 0.4
74 0.41
75 0.46
76 0.48
77 0.48
78 0.51
79 0.51
80 0.47
81 0.39
82 0.37
83 0.36
84 0.33
85 0.31
86 0.27