Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

K5XBL3

Protein Details
Accession K5XBL3    Localization Confidence Medium Confidence Score 12.9
NoLS Segment(s)
PositionSequenceProtein Nature
304-330HVKEIKLEQKPPKGRMRRAKLFYLRTAHydrophilic
NLS Segment(s)
PositionSequence
313-322KPPKGRMRRA
Subcellular Location(s) nucl 18.5, cyto_nucl 13, cyto 6.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR038657  L19_sf  
IPR012677  Nucleotide-bd_a/b_plait_sf  
IPR035979  RBD_domain_sf  
IPR001857  Ribosomal_L19  
IPR000504  RRM_dom  
IPR008991  Translation_prot_SH3-like_sf  
Gene Ontology GO:0005840  C:ribosome  
GO:0003723  F:RNA binding  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
KEGG abp:AGABI1DRAFT100088  -  
Pfam View protein in Pfam  
PF01245  Ribosomal_L19  
PF00076  RRM_1  
PROSITE View protein in PROSITE  
PS50102  RRM  
CDD cd12306  RRM_II_PABPs  
Amino Acid Sequences MADVEPTQPLPTASEDGQVNLNEEDDSKEIMLMKQRVEEMEREAKKLREMQAAAEKAADTSEGGESAPMDTEEDKNLIDSRSVYVGNVDYGATPEEIQGHFQSCGTINRVTILCDKFTGHPKGYAYVEFAESEHVDAALSMDNSLFRGRLIKVRRDQEDAVAPEEDTGEDIVDTVGTVRMGADEAAARRAQTAAYPFSKSALVPPTPSIPPPPRANVGRGLMEYLHKTLPTPEKQAMLTELFSRRSPKQLMPGSVVTVTLEHAPTTFTGVLIAIRRRGIDTSFVLRNIVQRTGVEMQFFVNSPHVKEIKLEQKPPKGRMRRAKLFYLRTAPDKMSVLAAGRSR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.22
3 0.23
4 0.26
5 0.24
6 0.23
7 0.19
8 0.19
9 0.14
10 0.15
11 0.16
12 0.14
13 0.15
14 0.13
15 0.14
16 0.14
17 0.17
18 0.24
19 0.25
20 0.25
21 0.26
22 0.28
23 0.29
24 0.3
25 0.3
26 0.28
27 0.35
28 0.36
29 0.36
30 0.39
31 0.39
32 0.41
33 0.46
34 0.44
35 0.42
36 0.41
37 0.44
38 0.49
39 0.49
40 0.44
41 0.38
42 0.32
43 0.24
44 0.23
45 0.17
46 0.08
47 0.08
48 0.08
49 0.07
50 0.07
51 0.07
52 0.07
53 0.07
54 0.08
55 0.06
56 0.07
57 0.09
58 0.1
59 0.11
60 0.12
61 0.11
62 0.12
63 0.14
64 0.13
65 0.13
66 0.12
67 0.13
68 0.14
69 0.14
70 0.13
71 0.13
72 0.13
73 0.12
74 0.12
75 0.1
76 0.07
77 0.08
78 0.09
79 0.08
80 0.08
81 0.08
82 0.1
83 0.1
84 0.12
85 0.12
86 0.13
87 0.13
88 0.13
89 0.14
90 0.13
91 0.15
92 0.17
93 0.17
94 0.15
95 0.17
96 0.17
97 0.18
98 0.23
99 0.21
100 0.19
101 0.19
102 0.2
103 0.21
104 0.28
105 0.31
106 0.26
107 0.28
108 0.28
109 0.3
110 0.3
111 0.27
112 0.22
113 0.18
114 0.17
115 0.15
116 0.14
117 0.12
118 0.11
119 0.11
120 0.08
121 0.07
122 0.06
123 0.06
124 0.06
125 0.06
126 0.06
127 0.05
128 0.05
129 0.05
130 0.06
131 0.07
132 0.06
133 0.05
134 0.08
135 0.09
136 0.16
137 0.2
138 0.27
139 0.34
140 0.4
141 0.43
142 0.45
143 0.44
144 0.4
145 0.41
146 0.35
147 0.3
148 0.24
149 0.21
150 0.16
151 0.16
152 0.13
153 0.07
154 0.06
155 0.04
156 0.03
157 0.04
158 0.03
159 0.03
160 0.03
161 0.03
162 0.03
163 0.03
164 0.03
165 0.03
166 0.03
167 0.04
168 0.04
169 0.04
170 0.05
171 0.05
172 0.07
173 0.07
174 0.07
175 0.07
176 0.08
177 0.07
178 0.08
179 0.1
180 0.13
181 0.14
182 0.16
183 0.16
184 0.17
185 0.17
186 0.16
187 0.17
188 0.18
189 0.16
190 0.16
191 0.17
192 0.2
193 0.2
194 0.21
195 0.23
196 0.22
197 0.27
198 0.29
199 0.31
200 0.33
201 0.34
202 0.36
203 0.35
204 0.34
205 0.3
206 0.27
207 0.25
208 0.2
209 0.2
210 0.19
211 0.15
212 0.14
213 0.12
214 0.12
215 0.16
216 0.24
217 0.26
218 0.29
219 0.29
220 0.31
221 0.31
222 0.32
223 0.29
224 0.23
225 0.2
226 0.19
227 0.2
228 0.2
229 0.22
230 0.25
231 0.24
232 0.29
233 0.32
234 0.31
235 0.37
236 0.42
237 0.43
238 0.43
239 0.43
240 0.39
241 0.35
242 0.32
243 0.22
244 0.16
245 0.14
246 0.11
247 0.1
248 0.08
249 0.08
250 0.08
251 0.08
252 0.12
253 0.11
254 0.09
255 0.09
256 0.1
257 0.12
258 0.16
259 0.18
260 0.16
261 0.17
262 0.18
263 0.19
264 0.21
265 0.2
266 0.2
267 0.22
268 0.25
269 0.27
270 0.27
271 0.27
272 0.26
273 0.3
274 0.28
275 0.26
276 0.22
277 0.19
278 0.24
279 0.28
280 0.28
281 0.24
282 0.21
283 0.2
284 0.21
285 0.21
286 0.17
287 0.18
288 0.18
289 0.19
290 0.26
291 0.26
292 0.25
293 0.27
294 0.34
295 0.39
296 0.45
297 0.52
298 0.54
299 0.63
300 0.71
301 0.76
302 0.78
303 0.78
304 0.81
305 0.83
306 0.85
307 0.85
308 0.82
309 0.85
310 0.84
311 0.81
312 0.78
313 0.75
314 0.69
315 0.64
316 0.62
317 0.54
318 0.49
319 0.44
320 0.37
321 0.3
322 0.27
323 0.25