Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

K5VJ19

Protein Details
Accession K5VJ19    Localization Confidence Medium Confidence Score 13
NoLS Segment(s)
PositionSequenceProtein Nature
55-85FCGRAGHMPRRCRKRKNTRKRAQERSRLPGTBasic
NLS Segment(s)
PositionSequence
63-81PRRCRKRKNTRKRAQERSR
Subcellular Location(s) nucl 18, cyto_nucl 11, mito 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR001878  Znf_CCHC  
IPR036875  Znf_CCHC_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0003676  F:nucleic acid binding  
GO:0008270  F:zinc ion binding  
KEGG abp:AGABI1DRAFT133360  -  
PROSITE View protein in PROSITE  
PS50158  ZF_CCHC  
Amino Acid Sequences MASQLRTHAPYAWDTTSTRLRASTSTTTPSGSHRPSPHSLGPISGPKDVAIACSFCGRAGHMPRRCRKRKNTRKRAQERSRLPGTSKSNVTGPLGHLSGIGAALPAVKTPPTPPGDVSTGSGSPGSDIPLRASALGAYSSPSSTPSSSSPPSSPLQLDADFFWLADTGATSHMTPHRH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.26
2 0.3
3 0.34
4 0.33
5 0.31
6 0.27
7 0.27
8 0.26
9 0.31
10 0.32
11 0.29
12 0.32
13 0.32
14 0.32
15 0.31
16 0.35
17 0.36
18 0.34
19 0.38
20 0.37
21 0.42
22 0.45
23 0.5
24 0.48
25 0.45
26 0.41
27 0.35
28 0.35
29 0.35
30 0.33
31 0.28
32 0.25
33 0.2
34 0.21
35 0.2
36 0.18
37 0.13
38 0.11
39 0.11
40 0.12
41 0.12
42 0.11
43 0.11
44 0.1
45 0.16
46 0.23
47 0.32
48 0.37
49 0.46
50 0.54
51 0.64
52 0.72
53 0.75
54 0.78
55 0.8
56 0.85
57 0.88
58 0.91
59 0.9
60 0.93
61 0.93
62 0.93
63 0.92
64 0.9
65 0.85
66 0.81
67 0.76
68 0.66
69 0.58
70 0.55
71 0.49
72 0.43
73 0.38
74 0.31
75 0.28
76 0.28
77 0.26
78 0.19
79 0.16
80 0.13
81 0.13
82 0.11
83 0.1
84 0.09
85 0.08
86 0.07
87 0.05
88 0.03
89 0.03
90 0.03
91 0.03
92 0.03
93 0.03
94 0.04
95 0.04
96 0.06
97 0.12
98 0.15
99 0.16
100 0.17
101 0.2
102 0.22
103 0.23
104 0.23
105 0.2
106 0.17
107 0.17
108 0.16
109 0.12
110 0.11
111 0.1
112 0.11
113 0.1
114 0.1
115 0.11
116 0.13
117 0.14
118 0.13
119 0.12
120 0.1
121 0.1
122 0.1
123 0.08
124 0.08
125 0.08
126 0.08
127 0.09
128 0.11
129 0.12
130 0.12
131 0.15
132 0.16
133 0.22
134 0.24
135 0.28
136 0.27
137 0.28
138 0.3
139 0.31
140 0.29
141 0.25
142 0.27
143 0.24
144 0.24
145 0.21
146 0.23
147 0.19
148 0.18
149 0.15
150 0.11
151 0.1
152 0.09
153 0.09
154 0.06
155 0.08
156 0.1
157 0.09
158 0.14