Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

K5VGF4

Protein Details
Accession K5VGF4    Localization Confidence Medium Confidence Score 10.8
NoLS Segment(s)
PositionSequenceProtein Nature
1-25MSRRCRKRKSAKKRAQERSRLPGTSBasic
NLS Segment(s)
PositionSequence
6-22RKRKSAKKRAQERSRLP
Subcellular Location(s) mito 12, nucl 10, cyto_nucl 8.5, cyto 5
Family & Domain DBs
KEGG abp:AGABI1DRAFT134799  -  
Amino Acid Sequences MSRRCRKRKSAKKRAQERSRLPGTSKSNVKGPLGHLSGIGAALPAVNTPPTPPGDVSTGSGSPGSDIPLRASALGAYSSLSSSPSSSSSPSSPLQLDADFFWLADT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.95
2 0.94
3 0.93
4 0.9
5 0.88
6 0.84
7 0.76
8 0.68
9 0.66
10 0.61
11 0.59
12 0.56
13 0.48
14 0.47
15 0.47
16 0.45
17 0.38
18 0.35
19 0.34
20 0.3
21 0.28
22 0.23
23 0.2
24 0.19
25 0.16
26 0.13
27 0.05
28 0.03
29 0.03
30 0.03
31 0.03
32 0.03
33 0.03
34 0.03
35 0.04
36 0.06
37 0.07
38 0.09
39 0.09
40 0.1
41 0.12
42 0.12
43 0.13
44 0.14
45 0.13
46 0.12
47 0.12
48 0.1
49 0.09
50 0.09
51 0.09
52 0.08
53 0.09
54 0.1
55 0.11
56 0.12
57 0.11
58 0.11
59 0.09
60 0.09
61 0.09
62 0.07
63 0.06
64 0.06
65 0.06
66 0.06
67 0.08
68 0.07
69 0.08
70 0.09
71 0.11
72 0.12
73 0.14
74 0.17
75 0.17
76 0.21
77 0.21
78 0.23
79 0.22
80 0.23
81 0.24
82 0.21
83 0.21
84 0.18
85 0.2
86 0.17