Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

Q0USC1

Protein Details
Accession Q0USC1    Localization Confidence Medium Confidence Score 14.4
NoLS Segment(s)
PositionSequenceProtein Nature
75-107EKVKKEYEEKQRLKREKRKTKEKEKDKAKEKEABasic
NLS Segment(s)
PositionSequence
78-106KKEYEEKQRLKREKRKTKEKEKDKAKEKE
Subcellular Location(s) nucl 23.5, cyto_nucl 13.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR013640  Vfa1  
Gene Ontology GO:0005768  C:endosome  
GO:0007034  P:vacuolar transport  
KEGG pno:SNOG_05343  -  
Pfam View protein in Pfam  
PF08432  Vfa1  
Amino Acid Sequences MENTWHLRKVADNASKACWICYKPTTSVLITPNNKDFFYICPGHLLDRGFCQPDAEEVTALEVKKKKDELDAQIEKVKKEYEEKQRLKREKRKTKEKEKDKAKEKEAQSKDEEEDKQDEKAKEDKIKELSKSKEQSQTELGPRIYHLNKSFYQSRLDKLRNAEVAKRNRERLNNPANFPSVPSGNPQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.45
2 0.49
3 0.46
4 0.41
5 0.37
6 0.31
7 0.32
8 0.35
9 0.36
10 0.33
11 0.37
12 0.39
13 0.36
14 0.39
15 0.38
16 0.42
17 0.41
18 0.43
19 0.45
20 0.43
21 0.41
22 0.37
23 0.33
24 0.26
25 0.29
26 0.27
27 0.21
28 0.22
29 0.23
30 0.23
31 0.25
32 0.24
33 0.18
34 0.19
35 0.22
36 0.21
37 0.2
38 0.19
39 0.16
40 0.17
41 0.2
42 0.17
43 0.14
44 0.12
45 0.14
46 0.16
47 0.16
48 0.18
49 0.18
50 0.18
51 0.22
52 0.24
53 0.22
54 0.27
55 0.33
56 0.35
57 0.41
58 0.43
59 0.41
60 0.44
61 0.44
62 0.38
63 0.33
64 0.28
65 0.19
66 0.21
67 0.27
68 0.33
69 0.43
70 0.5
71 0.58
72 0.66
73 0.74
74 0.79
75 0.81
76 0.81
77 0.81
78 0.84
79 0.86
80 0.86
81 0.88
82 0.89
83 0.89
84 0.88
85 0.87
86 0.87
87 0.85
88 0.83
89 0.75
90 0.73
91 0.67
92 0.67
93 0.6
94 0.55
95 0.48
96 0.43
97 0.41
98 0.39
99 0.36
100 0.28
101 0.29
102 0.26
103 0.26
104 0.3
105 0.28
106 0.26
107 0.3
108 0.33
109 0.35
110 0.36
111 0.39
112 0.39
113 0.44
114 0.45
115 0.48
116 0.48
117 0.5
118 0.52
119 0.52
120 0.54
121 0.5
122 0.49
123 0.47
124 0.48
125 0.44
126 0.45
127 0.4
128 0.32
129 0.32
130 0.35
131 0.32
132 0.32
133 0.3
134 0.3
135 0.32
136 0.37
137 0.41
138 0.36
139 0.42
140 0.38
141 0.41
142 0.46
143 0.47
144 0.46
145 0.46
146 0.52
147 0.51
148 0.51
149 0.53
150 0.53
151 0.59
152 0.64
153 0.66
154 0.66
155 0.67
156 0.72
157 0.69
158 0.71
159 0.72
160 0.69
161 0.67
162 0.64
163 0.6
164 0.52
165 0.49
166 0.44
167 0.35