Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

K5VMU2

Protein Details
Accession K5VMU2   
Localization Confidence Low
Confidence Score 7.7
NoLS Segment(s)
PositionSequenceProtein Nature
121-142TADSTKCTYKRHQNNISWHEQRHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 14, nucl 7, cyto 5
Family & Domain DBs
KEGG abp:AGABI1DRAFT15654  -  
Amino Acid Sequences VVRSRGSKDMAVAFVDVWDSKSGSRTKDLVNKVYHIRGKLIKVEYARQREFVPQCQKCWKWNHGTSRCRLSHQLCARCGQPHMTKNHTAFATCCGAARKREDWTGECKHEIKCINCKGNHTADSTKCTYKRHQNNISWHEQRH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.17
3 0.14
4 0.11
5 0.11
6 0.1
7 0.1
8 0.16
9 0.19
10 0.21
11 0.25
12 0.26
13 0.31
14 0.39
15 0.44
16 0.45
17 0.45
18 0.46
19 0.46
20 0.5
21 0.47
22 0.4
23 0.39
24 0.37
25 0.37
26 0.39
27 0.37
28 0.34
29 0.33
30 0.39
31 0.42
32 0.46
33 0.44
34 0.39
35 0.38
36 0.42
37 0.43
38 0.44
39 0.47
40 0.41
41 0.44
42 0.51
43 0.52
44 0.5
45 0.54
46 0.52
47 0.5
48 0.55
49 0.62
50 0.63
51 0.66
52 0.63
53 0.65
54 0.6
55 0.54
56 0.52
57 0.44
58 0.43
59 0.46
60 0.47
61 0.4
62 0.4
63 0.39
64 0.35
65 0.33
66 0.3
67 0.29
68 0.28
69 0.32
70 0.35
71 0.39
72 0.38
73 0.42
74 0.36
75 0.31
76 0.25
77 0.24
78 0.23
79 0.18
80 0.18
81 0.16
82 0.19
83 0.22
84 0.27
85 0.26
86 0.26
87 0.31
88 0.33
89 0.33
90 0.38
91 0.41
92 0.4
93 0.41
94 0.4
95 0.37
96 0.4
97 0.43
98 0.4
99 0.42
100 0.47
101 0.52
102 0.51
103 0.55
104 0.55
105 0.56
106 0.54
107 0.49
108 0.48
109 0.43
110 0.47
111 0.47
112 0.49
113 0.45
114 0.47
115 0.51
116 0.55
117 0.62
118 0.67
119 0.72
120 0.73
121 0.8
122 0.83
123 0.84