Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

K5WY47

Protein Details
Accession K5WY47    Localization Confidence Medium Confidence Score 12
NoLS Segment(s)
PositionSequenceProtein Nature
140-165ALERVKKQLNSRKMKKKTRAKEIDEEHydrophilic
283-311IQQHNFQRSKRENRYSQRSRGRKNLHTAAHydrophilic
NLS Segment(s)
PositionSequence
146-159KQLNSRKMKKKTRA
Subcellular Location(s) cyto 7.5, cyto_nucl 7.5, mito 7, nucl 6.5, pero 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR011990  TPR-like_helical_dom_sf  
IPR019734  TPR_repeat  
IPR000571  Znf_CCCH  
Gene Ontology GO:0046872  F:metal ion binding  
KEGG abp:AGABI1DRAFT132191  -  
Pfam View protein in Pfam  
PF14559  TPR_19  
PROSITE View protein in PROSITE  
PS50005  TPR  
PS50103  ZF_C3H1  
Amino Acid Sequences MSTIELTPEEARERLVLKAKERKERIEANHEKASGIIQSGDESFNKGNFTEALEFYSQAVQLWNTNVHLLVKLATAHAKCKQFKEAVTAATRALYMDPSNPDARFQRGLARLELHKAGLALIDLETVLEINPTYPGLTSALERVKKQLNSRKMKKKTRAKEIDEELMGPLLEEDGIEEADLSDSEESKMVGNGIPCRHYNKKPAGCREGLNCKWMHAPDETSVRDTTGRNVCIYHLLDSCQFGEKCFYSHDKEWLPPNGWWTDPYKIAVMEEIVDMARMKARIQQHNFQRSKRENRYSQRSRGRKNLHTAASSSSGVPAWMMMSMDAYDNDLNDFRMQHCGFSQGDVEELMCQGVKPWDDDAWDVLHALSSY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.31
3 0.33
4 0.39
5 0.49
6 0.55
7 0.63
8 0.67
9 0.68
10 0.67
11 0.71
12 0.7
13 0.72
14 0.73
15 0.69
16 0.71
17 0.65
18 0.56
19 0.47
20 0.41
21 0.31
22 0.24
23 0.17
24 0.11
25 0.12
26 0.14
27 0.15
28 0.14
29 0.16
30 0.17
31 0.17
32 0.18
33 0.16
34 0.17
35 0.15
36 0.19
37 0.19
38 0.18
39 0.2
40 0.2
41 0.2
42 0.2
43 0.21
44 0.17
45 0.13
46 0.14
47 0.11
48 0.12
49 0.14
50 0.15
51 0.14
52 0.14
53 0.15
54 0.14
55 0.14
56 0.12
57 0.11
58 0.1
59 0.1
60 0.11
61 0.16
62 0.16
63 0.2
64 0.26
65 0.33
66 0.36
67 0.39
68 0.45
69 0.43
70 0.43
71 0.46
72 0.43
73 0.4
74 0.39
75 0.37
76 0.3
77 0.27
78 0.25
79 0.18
80 0.15
81 0.12
82 0.1
83 0.12
84 0.14
85 0.17
86 0.2
87 0.2
88 0.22
89 0.23
90 0.26
91 0.25
92 0.23
93 0.28
94 0.3
95 0.33
96 0.31
97 0.33
98 0.3
99 0.31
100 0.31
101 0.24
102 0.18
103 0.16
104 0.14
105 0.11
106 0.09
107 0.06
108 0.05
109 0.05
110 0.04
111 0.04
112 0.04
113 0.04
114 0.03
115 0.03
116 0.03
117 0.03
118 0.04
119 0.04
120 0.05
121 0.04
122 0.06
123 0.07
124 0.07
125 0.08
126 0.12
127 0.17
128 0.19
129 0.19
130 0.22
131 0.27
132 0.3
133 0.38
134 0.43
135 0.48
136 0.57
137 0.67
138 0.74
139 0.78
140 0.84
141 0.86
142 0.87
143 0.86
144 0.87
145 0.86
146 0.82
147 0.8
148 0.74
149 0.67
150 0.57
151 0.48
152 0.37
153 0.28
154 0.21
155 0.13
156 0.08
157 0.04
158 0.04
159 0.03
160 0.03
161 0.03
162 0.03
163 0.03
164 0.03
165 0.03
166 0.03
167 0.03
168 0.04
169 0.03
170 0.04
171 0.04
172 0.05
173 0.05
174 0.05
175 0.05
176 0.05
177 0.07
178 0.08
179 0.11
180 0.12
181 0.14
182 0.15
183 0.21
184 0.27
185 0.29
186 0.36
187 0.42
188 0.49
189 0.54
190 0.61
191 0.6
192 0.56
193 0.55
194 0.53
195 0.53
196 0.46
197 0.43
198 0.35
199 0.31
200 0.31
201 0.3
202 0.26
203 0.18
204 0.18
205 0.17
206 0.22
207 0.22
208 0.21
209 0.21
210 0.19
211 0.2
212 0.19
213 0.22
214 0.23
215 0.23
216 0.21
217 0.22
218 0.21
219 0.24
220 0.25
221 0.21
222 0.16
223 0.16
224 0.17
225 0.18
226 0.18
227 0.19
228 0.18
229 0.16
230 0.19
231 0.17
232 0.18
233 0.2
234 0.23
235 0.23
236 0.25
237 0.31
238 0.3
239 0.33
240 0.37
241 0.39
242 0.38
243 0.33
244 0.34
245 0.3
246 0.28
247 0.26
248 0.24
249 0.23
250 0.21
251 0.22
252 0.19
253 0.17
254 0.17
255 0.16
256 0.13
257 0.11
258 0.09
259 0.08
260 0.07
261 0.07
262 0.07
263 0.06
264 0.09
265 0.08
266 0.09
267 0.14
268 0.22
269 0.32
270 0.38
271 0.46
272 0.53
273 0.64
274 0.68
275 0.66
276 0.69
277 0.68
278 0.73
279 0.75
280 0.75
281 0.74
282 0.79
283 0.87
284 0.85
285 0.86
286 0.86
287 0.85
288 0.83
289 0.84
290 0.83
291 0.8
292 0.8
293 0.79
294 0.73
295 0.66
296 0.6
297 0.53
298 0.48
299 0.41
300 0.32
301 0.25
302 0.19
303 0.17
304 0.15
305 0.11
306 0.07
307 0.07
308 0.07
309 0.06
310 0.06
311 0.07
312 0.08
313 0.08
314 0.1
315 0.1
316 0.1
317 0.12
318 0.12
319 0.13
320 0.14
321 0.15
322 0.13
323 0.23
324 0.23
325 0.22
326 0.22
327 0.25
328 0.24
329 0.25
330 0.26
331 0.17
332 0.17
333 0.16
334 0.15
335 0.12
336 0.12
337 0.1
338 0.08
339 0.08
340 0.09
341 0.14
342 0.14
343 0.16
344 0.18
345 0.19
346 0.21
347 0.23
348 0.22
349 0.2
350 0.19
351 0.17
352 0.15