Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

K5WSY0

Protein Details
Accession K5WSY0    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
1-20TPGRTHNRSRSPSRQNRSVTHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 19.5, cyto_mito 12.333, cyto 4, cyto_nucl 3.333
Family & Domain DBs
KEGG abp:AGABI1DRAFT49526  -  
Amino Acid Sequences TPGRTHNRSRSPSRQNRSVTSGKGLALRVGCVGPWLEASGPSWDCLGGNF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.81
2 0.75
3 0.72
4 0.7
5 0.64
6 0.54
7 0.48
8 0.41
9 0.33
10 0.31
11 0.27
12 0.22
13 0.17
14 0.15
15 0.12
16 0.11
17 0.09
18 0.08
19 0.08
20 0.06
21 0.07
22 0.07
23 0.07
24 0.07
25 0.09
26 0.14
27 0.14
28 0.14
29 0.14
30 0.13