Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q0U2W3

Protein Details
Accession Q0U2W3    Localization Confidence Medium Confidence Score 10.1
NoLS Segment(s)
PositionSequenceProtein Nature
24-50ADSADPTNPNRRRRRRKVPEEETCNEAHydrophilic
NLS Segment(s)
PositionSequence
34-40RRRRRRK
Subcellular Location(s) cyto 10.5cyto_nucl 10.5, nucl 7.5, mito 2, extr 2, pero 2, E.R. 2
Family & Domain DBs
Gene Ontology GO:0005759  C:mitochondrial matrix  
GO:0033617  P:mitochondrial cytochrome c oxidase assembly  
KEGG pno:SNOG_13988  -  
Amino Acid Sequences MVSFLVVAAPHLIPCPVDPRTLSADSADPTNPNRRRRRRKVPEEETCNEAMGQDLRNKMLLDEKLAPKRECPLPKPGGLIGQVLGLKEEGGDVERISIKTRVEQARIEAQSKDEDQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.15
3 0.14
4 0.17
5 0.17
6 0.2
7 0.26
8 0.27
9 0.26
10 0.22
11 0.23
12 0.22
13 0.23
14 0.2
15 0.16
16 0.18
17 0.28
18 0.33
19 0.41
20 0.51
21 0.6
22 0.71
23 0.79
24 0.87
25 0.88
26 0.92
27 0.94
28 0.93
29 0.92
30 0.89
31 0.81
32 0.73
33 0.62
34 0.51
35 0.4
36 0.29
37 0.2
38 0.13
39 0.12
40 0.11
41 0.11
42 0.11
43 0.12
44 0.12
45 0.12
46 0.15
47 0.14
48 0.14
49 0.19
50 0.23
51 0.28
52 0.33
53 0.33
54 0.29
55 0.34
56 0.38
57 0.38
58 0.36
59 0.4
60 0.39
61 0.4
62 0.42
63 0.38
64 0.33
65 0.29
66 0.27
67 0.18
68 0.16
69 0.15
70 0.13
71 0.12
72 0.09
73 0.08
74 0.07
75 0.07
76 0.05
77 0.06
78 0.06
79 0.06
80 0.08
81 0.11
82 0.12
83 0.15
84 0.17
85 0.17
86 0.21
87 0.3
88 0.33
89 0.34
90 0.36
91 0.38
92 0.44
93 0.47
94 0.45
95 0.38
96 0.34