Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

K5WV45

Protein Details
Accession K5WV45   
Localization Confidence Medium
Confidence Score 14
NoLS Segment(s)
PositionSequenceProtein Nature
121-143VQPVTAQPERPRRERRNVPGAGRHydrophilic
NLS Segment(s)
PositionSequence
132-136RRERR
Subcellular Location(s) nucl 15, mito 10
Family & Domain DBs
InterPro View protein in InterPro  
IPR001210  Ribosomal_S17e  
IPR018273  Ribosomal_S17e_CS  
IPR036401  RPS17e-like_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
KEGG abp:AGABI1DRAFT116811  -  
Pfam View protein in Pfam  
PF00833  Ribosomal_S17e  
PROSITE View protein in PROSITE  
PS00712  RIBOSOMAL_S17E  
Amino Acid Sequences MGRVRTKTTKRASRVLIEKYYPRLTLDFHTNKRIIDEVSLVPSKRLRNKIAGFTTHLMKRIQKGPVRGISFKLQEEERERKDNYVPEISALDTTASGLEIDPDTKALLDALNFDSIQVNVVQPVTAQPERPRRERRNVPGAGRA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.72
2 0.7
3 0.66
4 0.61
5 0.59
6 0.57
7 0.55
8 0.47
9 0.41
10 0.34
11 0.31
12 0.3
13 0.36
14 0.38
15 0.38
16 0.44
17 0.43
18 0.42
19 0.42
20 0.39
21 0.3
22 0.23
23 0.22
24 0.16
25 0.2
26 0.22
27 0.2
28 0.2
29 0.23
30 0.28
31 0.32
32 0.38
33 0.36
34 0.42
35 0.46
36 0.53
37 0.53
38 0.49
39 0.45
40 0.41
41 0.42
42 0.35
43 0.34
44 0.27
45 0.25
46 0.27
47 0.28
48 0.33
49 0.31
50 0.33
51 0.36
52 0.41
53 0.43
54 0.4
55 0.37
56 0.35
57 0.34
58 0.3
59 0.26
60 0.2
61 0.2
62 0.25
63 0.29
64 0.28
65 0.31
66 0.31
67 0.32
68 0.34
69 0.34
70 0.32
71 0.29
72 0.25
73 0.21
74 0.21
75 0.2
76 0.17
77 0.14
78 0.1
79 0.06
80 0.06
81 0.05
82 0.05
83 0.04
84 0.04
85 0.05
86 0.05
87 0.06
88 0.06
89 0.06
90 0.06
91 0.06
92 0.06
93 0.05
94 0.06
95 0.05
96 0.08
97 0.09
98 0.11
99 0.1
100 0.11
101 0.11
102 0.11
103 0.12
104 0.1
105 0.08
106 0.08
107 0.08
108 0.08
109 0.07
110 0.09
111 0.15
112 0.16
113 0.2
114 0.27
115 0.37
116 0.44
117 0.53
118 0.62
119 0.64
120 0.74
121 0.81
122 0.82
123 0.82
124 0.84