Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

K5X8G9

Protein Details
Accession K5X8G9   
Localization Confidence Medium
Confidence Score 13.5
NoLS Segment(s)
PositionSequenceProtein Nature
113-142RTPSPERDRNSRPSKRRKLRHKVLKFTDVVBasic
NLS Segment(s)
PositionSequence
117-134PERDRNSRPSKRRKLRHK
Subcellular Location(s) nucl 19.5, cyto_nucl 12, mito 4
Family & Domain DBs
KEGG abp:AGABI1DRAFT110771  -  
Amino Acid Sequences MNQGPSLPPFSSIQQAMGQPAPSQSGNVPSARYQNADQRSPNKQTAVSGVKRPAPPPSNVTSADSSDLDDDENGELPASGLVAPWEVLRGLADVAIERAAKETDGSEPHSRTRTPSPERDRNSRPSKRRKLRHKVLKFTDVVTKGIISEAEARELF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.24
2 0.25
3 0.26
4 0.25
5 0.24
6 0.19
7 0.19
8 0.2
9 0.17
10 0.17
11 0.15
12 0.19
13 0.2
14 0.21
15 0.22
16 0.21
17 0.26
18 0.26
19 0.28
20 0.25
21 0.3
22 0.35
23 0.37
24 0.4
25 0.41
26 0.47
27 0.5
28 0.5
29 0.44
30 0.39
31 0.36
32 0.38
33 0.39
34 0.35
35 0.34
36 0.35
37 0.38
38 0.39
39 0.39
40 0.4
41 0.36
42 0.35
43 0.35
44 0.35
45 0.34
46 0.33
47 0.35
48 0.29
49 0.26
50 0.25
51 0.21
52 0.17
53 0.13
54 0.12
55 0.09
56 0.08
57 0.07
58 0.06
59 0.06
60 0.05
61 0.05
62 0.04
63 0.04
64 0.04
65 0.04
66 0.03
67 0.03
68 0.03
69 0.03
70 0.03
71 0.03
72 0.04
73 0.03
74 0.04
75 0.04
76 0.04
77 0.04
78 0.04
79 0.04
80 0.04
81 0.04
82 0.06
83 0.05
84 0.05
85 0.06
86 0.06
87 0.06
88 0.07
89 0.07
90 0.09
91 0.11
92 0.16
93 0.19
94 0.21
95 0.25
96 0.27
97 0.27
98 0.29
99 0.35
100 0.39
101 0.42
102 0.51
103 0.57
104 0.64
105 0.69
106 0.73
107 0.72
108 0.73
109 0.76
110 0.76
111 0.77
112 0.79
113 0.84
114 0.86
115 0.9
116 0.91
117 0.92
118 0.93
119 0.94
120 0.93
121 0.93
122 0.9
123 0.88
124 0.78
125 0.69
126 0.67
127 0.58
128 0.48
129 0.39
130 0.31
131 0.23
132 0.22
133 0.19
134 0.13
135 0.17
136 0.17