Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

K5VG04

Protein Details
Accession K5VG04    Localization Confidence Medium Confidence Score 11.8
NoLS Segment(s)
PositionSequenceProtein Nature
1-25MPRRCRKRKHARKRAQERSRLPGTSBasic
NLS Segment(s)
PositionSequence
4-20RCRKRKHARKRAQERSR
Subcellular Location(s) nucl 12.5, mito 12, cyto_nucl 8
Family & Domain DBs
KEGG abp:AGABI1DRAFT135264  -  
Amino Acid Sequences MPRRCRKRKHARKRAQERSRLPGTSKSNVTGPLGHLSGIGAALPAVKTPPTPPGDVSTGSGSPGSDIPLRASALGAYSSPSSSSSPSSPLQLDADFFWLADTGATSHMTPHRHWFKSYSPHRIPIRLADNSTVYSAG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.96
2 0.95
3 0.94
4 0.89
5 0.86
6 0.83
7 0.74
8 0.66
9 0.64
10 0.6
11 0.56
12 0.51
13 0.45
14 0.4
15 0.39
16 0.37
17 0.3
18 0.25
19 0.22
20 0.2
21 0.18
22 0.16
23 0.14
24 0.12
25 0.1
26 0.08
27 0.04
28 0.03
29 0.04
30 0.04
31 0.04
32 0.04
33 0.05
34 0.05
35 0.07
36 0.13
37 0.15
38 0.17
39 0.18
40 0.2
41 0.22
42 0.23
43 0.23
44 0.19
45 0.16
46 0.15
47 0.14
48 0.11
49 0.09
50 0.09
51 0.09
52 0.08
53 0.08
54 0.08
55 0.1
56 0.1
57 0.09
58 0.09
59 0.07
60 0.07
61 0.07
62 0.06
63 0.05
64 0.06
65 0.06
66 0.06
67 0.08
68 0.08
69 0.09
70 0.11
71 0.11
72 0.14
73 0.15
74 0.17
75 0.16
76 0.17
77 0.17
78 0.15
79 0.15
80 0.12
81 0.14
82 0.12
83 0.11
84 0.1
85 0.08
86 0.08
87 0.07
88 0.07
89 0.05
90 0.06
91 0.07
92 0.07
93 0.1
94 0.15
95 0.17
96 0.19
97 0.28
98 0.36
99 0.38
100 0.4
101 0.41
102 0.45
103 0.53
104 0.6
105 0.61
106 0.57
107 0.63
108 0.66
109 0.66
110 0.61
111 0.59
112 0.57
113 0.52
114 0.49
115 0.44
116 0.41
117 0.38