Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

K5WQK6

Protein Details
Accession K5WQK6    Localization Confidence Low Confidence Score 8.2
NoLS Segment(s)
PositionSequenceProtein Nature
2-23NEANRSPSVKWKHKGREFRGLDHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 9, cyto 7, mito 6, cyto_pero 6
Family & Domain DBs
KEGG abp:AGABI1DRAFT86527  -  
Amino Acid Sequences SNEANRSPSVKWKHKGREFRGLDDTQGRNPRAVGVAGTASKTVKGDVAGGKGARA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.74
2 0.83
3 0.79
4 0.8
5 0.74
6 0.71
7 0.68
8 0.57
9 0.51
10 0.46
11 0.41
12 0.36
13 0.39
14 0.34
15 0.27
16 0.27
17 0.25
18 0.2
19 0.19
20 0.13
21 0.08
22 0.1
23 0.1
24 0.11
25 0.11
26 0.1
27 0.1
28 0.1
29 0.1
30 0.09
31 0.09
32 0.12
33 0.15
34 0.17
35 0.21