Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

K5WLR0

Protein Details
Accession K5WLR0    Localization Confidence Low Confidence Score 9.7
NoLS Segment(s)
PositionSequenceProtein Nature
1-20MEKEKRRKRYTQRWDFSQEKBasic
NLS Segment(s)
Subcellular Location(s) nucl 16, cyto_nucl 10, mito 8
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
KEGG pco:PHACADRAFT_155488  -  
Amino Acid Sequences MEKEKRRKRYTQRWDFSQEKHYRSFNKQTGYPPVLLYVGFFTLRSIPVGIAILSRARQIKVD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.85
2 0.79
3 0.72
4 0.71
5 0.66
6 0.58
7 0.55
8 0.52
9 0.5
10 0.52
11 0.57
12 0.52
13 0.49
14 0.48
15 0.48
16 0.5
17 0.46
18 0.4
19 0.31
20 0.26
21 0.23
22 0.19
23 0.16
24 0.09
25 0.08
26 0.07
27 0.07
28 0.07
29 0.08
30 0.09
31 0.1
32 0.09
33 0.08
34 0.09
35 0.1
36 0.09
37 0.08
38 0.09
39 0.1
40 0.11
41 0.15
42 0.17