Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q0UCG4

Protein Details
Accession Q0UCG4   
Localization Confidence Medium
Confidence Score 12.6
NoLS Segment(s)
PositionSequenceProtein Nature
163-206PSAPSSAKKKPPTSKTPSRARKPQTRRRMSRPTRKPSSPPSQRSHydrophilic
NLS Segment(s)
PositionSequence
146-203RLPSPRRDRTLPSRPSPPSAPSSAKKKPPTSKTPSRARKPQTRRRMSRPTRKPSSPPS
Subcellular Location(s) nucl 16.5, cyto_nucl 11, mito 8
Family & Domain DBs
InterPro View protein in InterPro  
IPR016305  Mannose-6-P_Isomerase  
IPR046457  PMI_typeI_cat  
IPR014710  RmlC-like_jellyroll  
IPR011051  RmlC_Cupin_sf  
Gene Ontology GO:0004476  F:mannose-6-phosphate isomerase activity  
GO:0008270  F:zinc ion binding  
GO:0009298  P:GDP-mannose biosynthetic process  
KEGG pno:SNOG_10550  -  
Pfam View protein in Pfam  
PF20511  PMI_typeI_cat  
Amino Acid Sequences MRNPLIRLECGVNSYDWGKVGKTSAAAKFHAATASDFSIEEEKPYAELWMGTHPSLPSKDLETKRSLLDLVQENQALLSPEIAQKYENRLPFLFKVLSINKALSIQAHPNKKLAEQLHAKDPKNYPDDNPQARDDHRGHSLRWPLRLPSPRRDRTLPSRPSPPSAPSSAKKKPPTSKTPSRARKPQTRRRMSRPTRKPSSPPSQRS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.18
3 0.16
4 0.16
5 0.15
6 0.15
7 0.17
8 0.16
9 0.18
10 0.23
11 0.27
12 0.29
13 0.3
14 0.3
15 0.29
16 0.29
17 0.27
18 0.22
19 0.18
20 0.17
21 0.17
22 0.16
23 0.15
24 0.15
25 0.16
26 0.15
27 0.15
28 0.13
29 0.12
30 0.12
31 0.12
32 0.11
33 0.08
34 0.09
35 0.09
36 0.13
37 0.15
38 0.14
39 0.16
40 0.15
41 0.18
42 0.19
43 0.19
44 0.15
45 0.18
46 0.27
47 0.29
48 0.32
49 0.33
50 0.34
51 0.33
52 0.33
53 0.28
54 0.2
55 0.22
56 0.22
57 0.2
58 0.2
59 0.2
60 0.19
61 0.18
62 0.18
63 0.14
64 0.09
65 0.08
66 0.07
67 0.09
68 0.1
69 0.1
70 0.1
71 0.1
72 0.17
73 0.22
74 0.22
75 0.23
76 0.23
77 0.26
78 0.26
79 0.28
80 0.21
81 0.17
82 0.2
83 0.18
84 0.2
85 0.18
86 0.18
87 0.14
88 0.15
89 0.15
90 0.1
91 0.11
92 0.15
93 0.2
94 0.24
95 0.25
96 0.27
97 0.27
98 0.27
99 0.31
100 0.25
101 0.27
102 0.28
103 0.29
104 0.36
105 0.42
106 0.43
107 0.42
108 0.43
109 0.42
110 0.41
111 0.4
112 0.33
113 0.36
114 0.44
115 0.43
116 0.44
117 0.4
118 0.39
119 0.39
120 0.43
121 0.35
122 0.3
123 0.33
124 0.32
125 0.31
126 0.35
127 0.42
128 0.39
129 0.41
130 0.4
131 0.35
132 0.42
133 0.5
134 0.48
135 0.5
136 0.57
137 0.59
138 0.62
139 0.64
140 0.63
141 0.64
142 0.69
143 0.67
144 0.62
145 0.65
146 0.62
147 0.63
148 0.59
149 0.53
150 0.47
151 0.45
152 0.46
153 0.43
154 0.5
155 0.53
156 0.58
157 0.63
158 0.68
159 0.72
160 0.74
161 0.78
162 0.79
163 0.81
164 0.82
165 0.85
166 0.86
167 0.86
168 0.87
169 0.86
170 0.87
171 0.87
172 0.89
173 0.89
174 0.9
175 0.89
176 0.89
177 0.91
178 0.91
179 0.91
180 0.91
181 0.91
182 0.89
183 0.87
184 0.86
185 0.84
186 0.85