Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

K5W1C2

Protein Details
Accession K5W1C2   
Localization Confidence Low
Confidence Score 9.6
NoLS Segment(s)
PositionSequenceProtein Nature
137-159PAKVARRKSARVKRDPKPKSRAABasic
NLS Segment(s)
PositionSequence
106-165SPSPPRKARKSAVSVVRAKKPKAKASDGGASPAKVARRKSARVKRDPKPKSRAAVKSVKK
Subcellular Location(s) mito 15, cyto 6.5, cyto_nucl 6.5, nucl 5.5
Family & Domain DBs
KEGG pco:PHACADRAFT_198742  -  
Amino Acid Sequences MAVMAAGTGSRALAVREPEYEHLYAASILPYSYNIMVGVPVPPAGKVLLGESVEESRVKRLEKQQSRYRDRGGMFVPADTNPLLDVLLARGVNGESPQKQRSMAPSPSPPRKARKSAVSVVRAKKPKAKASDGGASPAKVARRKSARVKRDPKPKSRAAVKSVKKTANPGLGVQDNGAPTAGPSKLPPEPPSGARMGKARLKASGM
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.16
3 0.18
4 0.21
5 0.24
6 0.28
7 0.27
8 0.24
9 0.2
10 0.19
11 0.17
12 0.15
13 0.12
14 0.08
15 0.08
16 0.08
17 0.08
18 0.09
19 0.09
20 0.09
21 0.08
22 0.08
23 0.09
24 0.09
25 0.09
26 0.07
27 0.08
28 0.08
29 0.08
30 0.08
31 0.08
32 0.08
33 0.08
34 0.08
35 0.1
36 0.1
37 0.11
38 0.11
39 0.12
40 0.13
41 0.13
42 0.13
43 0.13
44 0.16
45 0.17
46 0.22
47 0.3
48 0.4
49 0.48
50 0.57
51 0.61
52 0.69
53 0.75
54 0.74
55 0.68
56 0.64
57 0.55
58 0.51
59 0.44
60 0.39
61 0.31
62 0.27
63 0.24
64 0.18
65 0.19
66 0.14
67 0.13
68 0.07
69 0.07
70 0.06
71 0.05
72 0.05
73 0.04
74 0.06
75 0.06
76 0.05
77 0.06
78 0.06
79 0.06
80 0.07
81 0.09
82 0.1
83 0.15
84 0.16
85 0.16
86 0.17
87 0.18
88 0.23
89 0.27
90 0.27
91 0.27
92 0.33
93 0.39
94 0.46
95 0.51
96 0.5
97 0.51
98 0.55
99 0.58
100 0.55
101 0.56
102 0.55
103 0.57
104 0.59
105 0.59
106 0.59
107 0.57
108 0.6
109 0.57
110 0.53
111 0.52
112 0.51
113 0.51
114 0.5
115 0.51
116 0.48
117 0.48
118 0.53
119 0.47
120 0.45
121 0.38
122 0.32
123 0.27
124 0.25
125 0.24
126 0.21
127 0.23
128 0.27
129 0.33
130 0.4
131 0.51
132 0.59
133 0.65
134 0.71
135 0.79
136 0.79
137 0.84
138 0.86
139 0.84
140 0.83
141 0.8
142 0.77
143 0.78
144 0.76
145 0.72
146 0.74
147 0.72
148 0.73
149 0.74
150 0.71
151 0.63
152 0.61
153 0.6
154 0.57
155 0.51
156 0.43
157 0.4
158 0.37
159 0.36
160 0.3
161 0.26
162 0.19
163 0.18
164 0.16
165 0.1
166 0.09
167 0.12
168 0.12
169 0.1
170 0.11
171 0.16
172 0.21
173 0.26
174 0.29
175 0.31
176 0.35
177 0.37
178 0.4
179 0.4
180 0.37
181 0.36
182 0.38
183 0.38
184 0.4
185 0.44
186 0.42