Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

K5WIH2

Protein Details
Accession K5WIH2    Localization Confidence Medium Confidence Score 14.3
NoLS Segment(s)
PositionSequenceProtein Nature
71-94RRFTRFPPAKPRPRPSTRRNYGKLBasic
NLS Segment(s)
PositionSequence
75-89RFPPAKPRPRPSTRR
Subcellular Location(s) nucl 24, cyto_nucl 14
Family & Domain DBs
KEGG pco:PHACADRAFT_249006  -  
Amino Acid Sequences MHVDDVGAQPEEKIGMQTMYESMPSYRSWIMLSACLQSGQKTSTFAGTGVIWNISRAPCTSLPQRLGQAARRFTRFPPAKPRPRPSTRRNYGKLRLDAILKAATSDATPRSHSSLADTKHRLPFCSRLDQPTRSGTSKM
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.09
2 0.09
3 0.09
4 0.1
5 0.11
6 0.1
7 0.11
8 0.11
9 0.1
10 0.11
11 0.11
12 0.14
13 0.14
14 0.14
15 0.14
16 0.16
17 0.16
18 0.18
19 0.19
20 0.17
21 0.16
22 0.17
23 0.17
24 0.14
25 0.15
26 0.14
27 0.13
28 0.13
29 0.14
30 0.14
31 0.14
32 0.13
33 0.12
34 0.11
35 0.11
36 0.09
37 0.1
38 0.08
39 0.08
40 0.1
41 0.08
42 0.09
43 0.09
44 0.12
45 0.12
46 0.16
47 0.2
48 0.23
49 0.26
50 0.26
51 0.27
52 0.26
53 0.27
54 0.3
55 0.31
56 0.32
57 0.32
58 0.33
59 0.33
60 0.31
61 0.39
62 0.37
63 0.36
64 0.41
65 0.49
66 0.57
67 0.64
68 0.72
69 0.71
70 0.76
71 0.8
72 0.79
73 0.8
74 0.79
75 0.8
76 0.79
77 0.78
78 0.78
79 0.78
80 0.72
81 0.63
82 0.56
83 0.47
84 0.41
85 0.35
86 0.27
87 0.19
88 0.16
89 0.13
90 0.11
91 0.09
92 0.11
93 0.12
94 0.12
95 0.15
96 0.17
97 0.21
98 0.22
99 0.22
100 0.25
101 0.3
102 0.31
103 0.38
104 0.41
105 0.43
106 0.5
107 0.51
108 0.47
109 0.45
110 0.51
111 0.47
112 0.52
113 0.5
114 0.51
115 0.57
116 0.58
117 0.57
118 0.56
119 0.56