Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

K5WH39

Protein Details
Accession K5WH39    Localization Confidence Low Confidence Score 8.1
NoLS Segment(s)
PositionSequenceProtein Nature
57-79SDPAGWHRQRERRKDGGREPHVDBasic
NLS Segment(s)
Subcellular Location(s) cyto_nucl 12.5, nucl 11.5, cyto 10.5, mito 3
Family & Domain DBs
KEGG pco:PHACADRAFT_193527  -  
Amino Acid Sequences MNSFWTLLDWFFPAIRLTDDVRLDDPEAFAGRSYALHARTLSTPSRSLAQPQRLQTSDPAGWHRQRERRKDGGREPHVDREQRESELVAALRRENEELRARVQQLERDLQLTRQSVAYAHDVSVPALPLDIGLPPPPKMPQSADLAALRTAYGALAASHASVQQALRERNEEVSSLRTYLTKTDDMSGAQLIQAIRDLNSEILQLAASVADEFTGKFDRRVNYARPSDRETLYPAVGVRTAAPFFGAAPDALAMAGGTMTTSNAALMIPSRMAVASRSLFVDVGGGTPFDEALMEDAFAGSLPQEEEDRVLCTVEIGLACVRKIEGAEESAPTSPTPEMATTPSNGANAISRVNSISSSTDASAKILDRNLLVKPKVMLDSVTKLLQL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.15
3 0.16
4 0.18
5 0.23
6 0.24
7 0.26
8 0.26
9 0.27
10 0.27
11 0.25
12 0.22
13 0.19
14 0.18
15 0.16
16 0.15
17 0.13
18 0.12
19 0.11
20 0.14
21 0.17
22 0.17
23 0.2
24 0.2
25 0.22
26 0.24
27 0.29
28 0.3
29 0.28
30 0.29
31 0.28
32 0.32
33 0.3
34 0.36
35 0.4
36 0.45
37 0.48
38 0.51
39 0.57
40 0.53
41 0.55
42 0.49
43 0.47
44 0.4
45 0.37
46 0.38
47 0.39
48 0.43
49 0.48
50 0.54
51 0.57
52 0.64
53 0.7
54 0.73
55 0.76
56 0.79
57 0.81
58 0.82
59 0.84
60 0.82
61 0.79
62 0.75
63 0.74
64 0.73
65 0.67
66 0.59
67 0.56
68 0.51
69 0.46
70 0.42
71 0.33
72 0.26
73 0.25
74 0.25
75 0.18
76 0.17
77 0.16
78 0.17
79 0.18
80 0.19
81 0.16
82 0.21
83 0.26
84 0.27
85 0.29
86 0.32
87 0.32
88 0.35
89 0.37
90 0.34
91 0.32
92 0.35
93 0.32
94 0.29
95 0.28
96 0.25
97 0.28
98 0.26
99 0.22
100 0.18
101 0.17
102 0.16
103 0.18
104 0.19
105 0.15
106 0.14
107 0.15
108 0.15
109 0.15
110 0.15
111 0.13
112 0.09
113 0.08
114 0.07
115 0.05
116 0.05
117 0.05
118 0.05
119 0.08
120 0.1
121 0.1
122 0.12
123 0.13
124 0.14
125 0.16
126 0.18
127 0.18
128 0.23
129 0.23
130 0.25
131 0.24
132 0.24
133 0.22
134 0.19
135 0.16
136 0.1
137 0.09
138 0.05
139 0.05
140 0.04
141 0.04
142 0.04
143 0.04
144 0.04
145 0.05
146 0.05
147 0.05
148 0.06
149 0.06
150 0.08
151 0.14
152 0.15
153 0.16
154 0.18
155 0.19
156 0.2
157 0.21
158 0.19
159 0.14
160 0.16
161 0.15
162 0.14
163 0.14
164 0.12
165 0.12
166 0.13
167 0.16
168 0.14
169 0.14
170 0.15
171 0.15
172 0.14
173 0.15
174 0.12
175 0.09
176 0.07
177 0.09
178 0.07
179 0.06
180 0.07
181 0.07
182 0.07
183 0.07
184 0.07
185 0.06
186 0.06
187 0.06
188 0.05
189 0.05
190 0.05
191 0.04
192 0.04
193 0.03
194 0.03
195 0.03
196 0.03
197 0.03
198 0.03
199 0.03
200 0.05
201 0.08
202 0.09
203 0.1
204 0.15
205 0.16
206 0.21
207 0.25
208 0.29
209 0.34
210 0.41
211 0.44
212 0.43
213 0.47
214 0.47
215 0.43
216 0.39
217 0.35
218 0.3
219 0.26
220 0.23
221 0.18
222 0.14
223 0.14
224 0.13
225 0.1
226 0.09
227 0.09
228 0.08
229 0.08
230 0.07
231 0.07
232 0.08
233 0.07
234 0.05
235 0.05
236 0.05
237 0.05
238 0.05
239 0.05
240 0.03
241 0.03
242 0.03
243 0.02
244 0.02
245 0.02
246 0.03
247 0.03
248 0.03
249 0.03
250 0.04
251 0.04
252 0.04
253 0.05
254 0.05
255 0.05
256 0.05
257 0.06
258 0.06
259 0.06
260 0.07
261 0.1
262 0.1
263 0.11
264 0.12
265 0.12
266 0.12
267 0.12
268 0.12
269 0.08
270 0.08
271 0.07
272 0.06
273 0.06
274 0.06
275 0.06
276 0.05
277 0.05
278 0.04
279 0.05
280 0.06
281 0.05
282 0.05
283 0.05
284 0.05
285 0.05
286 0.05
287 0.03
288 0.04
289 0.04
290 0.05
291 0.06
292 0.07
293 0.08
294 0.09
295 0.11
296 0.11
297 0.11
298 0.1
299 0.09
300 0.09
301 0.1
302 0.09
303 0.08
304 0.1
305 0.11
306 0.11
307 0.11
308 0.11
309 0.1
310 0.1
311 0.11
312 0.11
313 0.13
314 0.15
315 0.16
316 0.18
317 0.18
318 0.18
319 0.16
320 0.16
321 0.13
322 0.12
323 0.13
324 0.13
325 0.13
326 0.16
327 0.19
328 0.18
329 0.2
330 0.21
331 0.19
332 0.18
333 0.17
334 0.17
335 0.16
336 0.17
337 0.15
338 0.14
339 0.15
340 0.16
341 0.16
342 0.15
343 0.15
344 0.15
345 0.17
346 0.17
347 0.2
348 0.19
349 0.19
350 0.2
351 0.2
352 0.22
353 0.21
354 0.22
355 0.21
356 0.23
357 0.28
358 0.33
359 0.33
360 0.32
361 0.32
362 0.34
363 0.35
364 0.33
365 0.3
366 0.27
367 0.32
368 0.32