Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

K5VXL8

Protein Details
Accession K5VXL8   
Localization Confidence Low
Confidence Score 7.1
NoLS Segment(s)
PositionSequenceProtein Nature
44-64ETPGPRSHRGRQQPDLRAKERBasic
NLS Segment(s)
Subcellular Location(s) nucl 6cyto 6cyto_nucl 6, plas 5, extr 5
Family & Domain DBs
KEGG pco:PHACADRAFT_253346  -  
Amino Acid Sequences MDDKFERERFLVFALSTITTSPLFIWSRNCICLASAAGLVSPVETPGPRSHRGRQQPDLRAKERTRWR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.15
3 0.13
4 0.12
5 0.12
6 0.1
7 0.1
8 0.09
9 0.12
10 0.13
11 0.14
12 0.16
13 0.2
14 0.21
15 0.22
16 0.22
17 0.18
18 0.17
19 0.17
20 0.14
21 0.1
22 0.09
23 0.07
24 0.07
25 0.07
26 0.06
27 0.05
28 0.05
29 0.04
30 0.04
31 0.05
32 0.07
33 0.13
34 0.19
35 0.24
36 0.29
37 0.37
38 0.46
39 0.56
40 0.62
41 0.66
42 0.7
43 0.75
44 0.8
45 0.82
46 0.76
47 0.75
48 0.7