Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

K5W6U3

Protein Details
Accession K5W6U3    Localization Confidence Medium Confidence Score 10.6
NoLS Segment(s)
PositionSequenceProtein Nature
41-61IRILEFRKQRDKRSRCSRSRLHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 14, mito 11
Family & Domain DBs
KEGG pco:PHACADRAFT_258999  -  
Amino Acid Sequences MGLTTFPALEWLNLTSCAWNNRHAVRWKRRTHLHSLMLELIRILEFRKQRDKRSRCSRSRL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.12
3 0.14
4 0.19
5 0.19
6 0.22
7 0.25
8 0.26
9 0.33
10 0.4
11 0.47
12 0.53
13 0.62
14 0.63
15 0.66
16 0.71
17 0.69
18 0.69
19 0.67
20 0.63
21 0.54
22 0.5
23 0.48
24 0.4
25 0.35
26 0.26
27 0.18
28 0.12
29 0.11
30 0.1
31 0.11
32 0.15
33 0.21
34 0.33
35 0.38
36 0.49
37 0.6
38 0.67
39 0.72
40 0.79
41 0.85