Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

K5VI00

Protein Details
Accession K5VI00   
Localization Confidence Medium
Confidence Score 10.5
NoLS Segment(s)
PositionSequenceProtein Nature
2-24TNGERMRRGLPPKKPHFRRAAGTBasic
NLS Segment(s)
PositionSequence
8-23RRGLPPKKPHFRRAAG
Subcellular Location(s) mito 16, nucl 7.5, cyto_nucl 5, pero 2
Family & Domain DBs
KEGG pco:PHACADRAFT_103818  -  
Amino Acid Sequences MTNGERMRRGLPPKKPHFRRAAGTPPRPLLSRNGNEFGEYGYTTTRDDALTVTINNCTGSPFGIVSSNGYQAYSYIGGISGYANDSPDLRDGSSNYVYIGGVTETDPLATPQNIDNSFTAATEIQEAAESAIWSFRNGGDGLRAQWVNSDGSTPTNRLVYVPDEGVFVLVGDVAAFENAFGPVSEAVSSCCSLQLCSMRQY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.79
2 0.84
3 0.85
4 0.85
5 0.83
6 0.79
7 0.77
8 0.77
9 0.76
10 0.75
11 0.72
12 0.66
13 0.62
14 0.56
15 0.49
16 0.46
17 0.45
18 0.45
19 0.45
20 0.45
21 0.43
22 0.43
23 0.41
24 0.35
25 0.27
26 0.2
27 0.14
28 0.11
29 0.12
30 0.11
31 0.12
32 0.12
33 0.1
34 0.1
35 0.1
36 0.1
37 0.11
38 0.11
39 0.11
40 0.11
41 0.12
42 0.11
43 0.11
44 0.1
45 0.08
46 0.08
47 0.08
48 0.08
49 0.08
50 0.09
51 0.09
52 0.11
53 0.12
54 0.14
55 0.13
56 0.13
57 0.12
58 0.1
59 0.12
60 0.09
61 0.08
62 0.06
63 0.06
64 0.06
65 0.06
66 0.06
67 0.04
68 0.05
69 0.05
70 0.05
71 0.05
72 0.06
73 0.06
74 0.08
75 0.08
76 0.08
77 0.08
78 0.09
79 0.13
80 0.14
81 0.13
82 0.12
83 0.11
84 0.11
85 0.1
86 0.09
87 0.05
88 0.04
89 0.05
90 0.05
91 0.04
92 0.05
93 0.05
94 0.05
95 0.07
96 0.06
97 0.07
98 0.08
99 0.13
100 0.13
101 0.15
102 0.14
103 0.14
104 0.15
105 0.14
106 0.13
107 0.09
108 0.09
109 0.08
110 0.08
111 0.06
112 0.06
113 0.06
114 0.06
115 0.06
116 0.06
117 0.05
118 0.07
119 0.07
120 0.07
121 0.08
122 0.08
123 0.09
124 0.09
125 0.1
126 0.11
127 0.12
128 0.13
129 0.16
130 0.16
131 0.14
132 0.15
133 0.17
134 0.15
135 0.14
136 0.14
137 0.1
138 0.14
139 0.16
140 0.16
141 0.16
142 0.16
143 0.16
144 0.15
145 0.17
146 0.16
147 0.17
148 0.16
149 0.15
150 0.15
151 0.14
152 0.14
153 0.12
154 0.09
155 0.06
156 0.05
157 0.04
158 0.03
159 0.04
160 0.04
161 0.04
162 0.04
163 0.04
164 0.04
165 0.05
166 0.05
167 0.05
168 0.07
169 0.07
170 0.08
171 0.09
172 0.09
173 0.11
174 0.13
175 0.14
176 0.12
177 0.15
178 0.14
179 0.14
180 0.2
181 0.25