Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

K5UT96

Protein Details
Accession K5UT96    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
1-23MPPQMPRRRVQMQKRPVPYVKKVHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 20, cyto 3, extr 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR019591  Mrp/NBP35_ATP-bd  
IPR044304  NUBPL-like  
IPR027417  P-loop_NTPase  
IPR033756  YlxH/NBP35  
Gene Ontology GO:0005524  F:ATP binding  
GO:0140663  F:ATP-dependent FeS chaperone activity  
GO:0051536  F:iron-sulfur cluster binding  
GO:0016226  P:iron-sulfur cluster assembly  
KEGG pco:PHACADRAFT_259348  -  
Pfam View protein in Pfam  
PF10609  ParA  
CDD cd02037  Mrp_NBP35  
Amino Acid Sequences MPPQMPRRRVQMQKRPVPYVKKVIVVASGKGGVGKSTVAVNLAFALAAGQGFPQGRLRVGLLDLDIFGPSLPKLMGLDAAEESHLTEGGAIIPLTNHGMPCMSMGFLLPRPSPSASSNVDTAVVWRGLMVQKAVQQLLFDVDWRDQHSGTALDVLVVDMPPGTGDVPLTLGQLVQVDGAVIVSTPQDVALSDVRKGISMFRKISVPVAGLLLNQSHYTCPSCSTPHHIFGPPTAFRRFATDLNVKILGELPVLSSVSVSGDRGVPLTLHAKNEGEREWRDIMKRAADEVWNSINS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.84
2 0.84
3 0.82
4 0.81
5 0.77
6 0.76
7 0.69
8 0.64
9 0.58
10 0.51
11 0.5
12 0.44
13 0.37
14 0.3
15 0.27
16 0.22
17 0.22
18 0.2
19 0.13
20 0.12
21 0.11
22 0.09
23 0.09
24 0.1
25 0.1
26 0.1
27 0.09
28 0.09
29 0.09
30 0.07
31 0.06
32 0.06
33 0.05
34 0.05
35 0.04
36 0.04
37 0.06
38 0.07
39 0.09
40 0.13
41 0.13
42 0.14
43 0.16
44 0.16
45 0.15
46 0.15
47 0.15
48 0.11
49 0.11
50 0.11
51 0.1
52 0.09
53 0.07
54 0.06
55 0.06
56 0.06
57 0.06
58 0.06
59 0.06
60 0.06
61 0.07
62 0.09
63 0.08
64 0.1
65 0.09
66 0.1
67 0.09
68 0.09
69 0.09
70 0.07
71 0.07
72 0.05
73 0.04
74 0.04
75 0.05
76 0.05
77 0.05
78 0.04
79 0.04
80 0.05
81 0.07
82 0.07
83 0.07
84 0.06
85 0.07
86 0.07
87 0.08
88 0.08
89 0.06
90 0.05
91 0.06
92 0.08
93 0.09
94 0.12
95 0.12
96 0.12
97 0.15
98 0.16
99 0.18
100 0.17
101 0.21
102 0.2
103 0.22
104 0.21
105 0.19
106 0.19
107 0.16
108 0.15
109 0.12
110 0.1
111 0.08
112 0.07
113 0.08
114 0.09
115 0.1
116 0.09
117 0.08
118 0.12
119 0.14
120 0.14
121 0.12
122 0.11
123 0.11
124 0.12
125 0.11
126 0.08
127 0.07
128 0.08
129 0.09
130 0.11
131 0.12
132 0.1
133 0.1
134 0.11
135 0.1
136 0.09
137 0.09
138 0.07
139 0.06
140 0.06
141 0.06
142 0.05
143 0.04
144 0.04
145 0.03
146 0.03
147 0.03
148 0.03
149 0.03
150 0.03
151 0.03
152 0.03
153 0.05
154 0.06
155 0.06
156 0.06
157 0.05
158 0.05
159 0.06
160 0.06
161 0.04
162 0.04
163 0.03
164 0.03
165 0.03
166 0.03
167 0.02
168 0.03
169 0.03
170 0.03
171 0.03
172 0.03
173 0.03
174 0.03
175 0.06
176 0.1
177 0.11
178 0.11
179 0.13
180 0.13
181 0.14
182 0.14
183 0.18
184 0.21
185 0.26
186 0.27
187 0.27
188 0.29
189 0.29
190 0.3
191 0.26
192 0.2
193 0.14
194 0.14
195 0.12
196 0.11
197 0.11
198 0.1
199 0.09
200 0.09
201 0.09
202 0.08
203 0.1
204 0.12
205 0.12
206 0.14
207 0.16
208 0.19
209 0.21
210 0.29
211 0.31
212 0.34
213 0.37
214 0.37
215 0.35
216 0.36
217 0.4
218 0.36
219 0.35
220 0.33
221 0.31
222 0.28
223 0.34
224 0.34
225 0.29
226 0.33
227 0.35
228 0.35
229 0.37
230 0.38
231 0.31
232 0.28
233 0.28
234 0.21
235 0.15
236 0.13
237 0.09
238 0.1
239 0.1
240 0.1
241 0.08
242 0.07
243 0.09
244 0.09
245 0.09
246 0.09
247 0.1
248 0.1
249 0.11
250 0.11
251 0.09
252 0.12
253 0.18
254 0.19
255 0.2
256 0.22
257 0.24
258 0.26
259 0.3
260 0.31
261 0.31
262 0.31
263 0.34
264 0.36
265 0.39
266 0.4
267 0.43
268 0.43
269 0.44
270 0.43
271 0.41
272 0.4
273 0.39
274 0.37
275 0.36