Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

K5WJK8

Protein Details
Accession K5WJK8   
Localization Confidence Medium
Confidence Score 10.7
NoLS Segment(s)
PositionSequenceProtein Nature
188-213DPEILFCYKKRRKADKRFFTMLKKKFHydrophilic
NLS Segment(s)
PositionSequence
197-201KRRKA
Subcellular Location(s) cyto_nucl 11, nucl 10, cyto 10, pero 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR033684  EFM6  
IPR019410  Methyltransf_16  
IPR029063  SAM-dependent_MTases_sf  
Gene Ontology GO:0005737  C:cytoplasm  
GO:0016279  F:protein-lysine N-methyltransferase activity  
GO:0018022  P:peptidyl-lysine methylation  
KEGG pco:PHACADRAFT_191971  -  
Pfam View protein in Pfam  
PF10294  Methyltransf_16  
CDD cd02440  AdoMet_MTases  
Amino Acid Sequences MASELELEEQFDTLDPLRHLRNGGELGLVPAQPPSIHNEDLQLAFPSAGGRVPNPVSIRLLTDASPGCGGITWLAGEILSAYVCRRGSLKGKNVLELGSGTGLVGLVTGVLGAQVWITDQAPLLGIMAHNVEINNLSHRVSVMELNWGESLPSDLPRFDIILAADCVYFEPAFPLLVQTLDKLAARGDPEILFCYKKRRKADKRFFTMLKKKFNWTEVDDDPNKEQYNRDAVSLFRPAIEISIASCHK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.14
3 0.17
4 0.2
5 0.22
6 0.24
7 0.22
8 0.27
9 0.25
10 0.24
11 0.22
12 0.2
13 0.2
14 0.21
15 0.2
16 0.14
17 0.12
18 0.12
19 0.11
20 0.11
21 0.15
22 0.18
23 0.19
24 0.19
25 0.21
26 0.23
27 0.24
28 0.25
29 0.2
30 0.15
31 0.14
32 0.13
33 0.11
34 0.09
35 0.1
36 0.09
37 0.08
38 0.12
39 0.14
40 0.18
41 0.19
42 0.2
43 0.21
44 0.21
45 0.23
46 0.2
47 0.2
48 0.16
49 0.19
50 0.17
51 0.16
52 0.16
53 0.13
54 0.11
55 0.1
56 0.1
57 0.06
58 0.06
59 0.05
60 0.05
61 0.05
62 0.04
63 0.04
64 0.04
65 0.04
66 0.04
67 0.04
68 0.04
69 0.08
70 0.08
71 0.09
72 0.1
73 0.13
74 0.21
75 0.28
76 0.36
77 0.41
78 0.42
79 0.43
80 0.43
81 0.39
82 0.32
83 0.24
84 0.18
85 0.09
86 0.08
87 0.06
88 0.05
89 0.05
90 0.04
91 0.03
92 0.02
93 0.02
94 0.02
95 0.02
96 0.02
97 0.02
98 0.02
99 0.02
100 0.02
101 0.02
102 0.02
103 0.03
104 0.03
105 0.04
106 0.04
107 0.04
108 0.04
109 0.04
110 0.04
111 0.04
112 0.04
113 0.04
114 0.04
115 0.04
116 0.04
117 0.04
118 0.04
119 0.05
120 0.06
121 0.07
122 0.08
123 0.08
124 0.07
125 0.08
126 0.08
127 0.08
128 0.09
129 0.08
130 0.12
131 0.11
132 0.13
133 0.13
134 0.12
135 0.11
136 0.1
137 0.11
138 0.07
139 0.09
140 0.09
141 0.09
142 0.1
143 0.11
144 0.11
145 0.09
146 0.1
147 0.08
148 0.1
149 0.1
150 0.1
151 0.09
152 0.08
153 0.08
154 0.09
155 0.08
156 0.06
157 0.07
158 0.07
159 0.07
160 0.07
161 0.08
162 0.07
163 0.08
164 0.08
165 0.07
166 0.08
167 0.09
168 0.09
169 0.08
170 0.09
171 0.1
172 0.11
173 0.11
174 0.12
175 0.11
176 0.12
177 0.14
178 0.16
179 0.16
180 0.17
181 0.27
182 0.32
183 0.4
184 0.49
185 0.58
186 0.67
187 0.77
188 0.87
189 0.87
190 0.89
191 0.89
192 0.84
193 0.84
194 0.83
195 0.79
196 0.78
197 0.71
198 0.69
199 0.66
200 0.65
201 0.6
202 0.54
203 0.53
204 0.47
205 0.52
206 0.48
207 0.46
208 0.45
209 0.44
210 0.42
211 0.36
212 0.34
213 0.31
214 0.36
215 0.34
216 0.32
217 0.28
218 0.28
219 0.31
220 0.34
221 0.29
222 0.21
223 0.21
224 0.19
225 0.19
226 0.18
227 0.14
228 0.1