Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q0UNX4

Protein Details
Accession Q0UNX4   
Localization Confidence Low
Confidence Score 5.4
NoLS Segment(s)
PositionSequenceProtein Nature
11-32LSKAADKKWKHRVNYTDKHNGNHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 15, cyto 6, pero 3, nucl 1, plas 1, cysk 1
Family & Domain DBs
InterPro View protein in InterPro  
IPR036188  FAD/NAD-bd_sf  
IPR000960  Flavin_mOase  
IPR020946  Flavin_mOase-like  
Gene Ontology GO:0050660  F:flavin adenine dinucleotide binding  
GO:0004499  F:N,N-dimethylaniline monooxygenase activity  
GO:0050661  F:NADP binding  
KEGG pno:SNOG_06540  -  
Pfam View protein in Pfam  
PF00743  FMO-like  
Amino Acid Sequences MGCRVTGIEPLSKAADKKWKHRVNYTDKHNGNEQQTFDCSHIAICTGLHVEPNIPNLPGIENIKGEVFHSSSYKKRAQLTGRDVLIMGCGETAMDIAYEAIKSDAKSVTMCFRTGFLSFPKALSRFKVFGKQFKGGLPIDGLITNLFETAYVHRAIAASRFRWFVSDFVIKRVLWFLTGTQAGMNQHVGALPHDRLGRAFVFLNKSSKAMPYLNRPYQEKHPLGFLGNGYVDPPEDAQSKRWVDTCSFPSHIDAIGRVLFEPRPDRKDWRRLKDAEIRPDCVVYCTGYKQSFSWLDPSYPTASDASIRNIVAPEETSIAFIGFVRPGVGAIPPIAEQQAMWWTALITGRMALPTDPPHYHLLAKSSSRIQYGVDHSAYMSTLAKDFGGAPGLVELWKVHGFKVLLVYCFGASFVTFYRLLGPFRCKEAPGIARTELAETILRRGVLGNVFFGVSTSMH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.3
2 0.37
3 0.39
4 0.48
5 0.57
6 0.62
7 0.66
8 0.74
9 0.77
10 0.79
11 0.82
12 0.82
13 0.81
14 0.76
15 0.73
16 0.71
17 0.67
18 0.62
19 0.58
20 0.51
21 0.44
22 0.43
23 0.41
24 0.35
25 0.29
26 0.23
27 0.18
28 0.16
29 0.13
30 0.12
31 0.1
32 0.1
33 0.11
34 0.11
35 0.12
36 0.12
37 0.13
38 0.15
39 0.2
40 0.19
41 0.18
42 0.17
43 0.17
44 0.18
45 0.19
46 0.21
47 0.18
48 0.17
49 0.18
50 0.19
51 0.18
52 0.17
53 0.16
54 0.14
55 0.13
56 0.17
57 0.2
58 0.25
59 0.32
60 0.38
61 0.39
62 0.44
63 0.51
64 0.55
65 0.61
66 0.63
67 0.63
68 0.58
69 0.54
70 0.48
71 0.39
72 0.33
73 0.23
74 0.15
75 0.07
76 0.06
77 0.05
78 0.05
79 0.05
80 0.03
81 0.03
82 0.03
83 0.04
84 0.04
85 0.04
86 0.05
87 0.06
88 0.07
89 0.08
90 0.11
91 0.12
92 0.12
93 0.13
94 0.15
95 0.21
96 0.22
97 0.22
98 0.19
99 0.2
100 0.21
101 0.2
102 0.21
103 0.16
104 0.19
105 0.19
106 0.2
107 0.24
108 0.24
109 0.26
110 0.27
111 0.3
112 0.28
113 0.3
114 0.39
115 0.38
116 0.43
117 0.47
118 0.46
119 0.43
120 0.41
121 0.44
122 0.35
123 0.32
124 0.25
125 0.2
126 0.17
127 0.15
128 0.14
129 0.08
130 0.08
131 0.07
132 0.06
133 0.05
134 0.04
135 0.06
136 0.07
137 0.09
138 0.09
139 0.09
140 0.1
141 0.1
142 0.11
143 0.15
144 0.17
145 0.16
146 0.18
147 0.19
148 0.19
149 0.2
150 0.21
151 0.16
152 0.18
153 0.25
154 0.23
155 0.25
156 0.28
157 0.26
158 0.26
159 0.27
160 0.21
161 0.14
162 0.14
163 0.11
164 0.12
165 0.12
166 0.12
167 0.1
168 0.12
169 0.11
170 0.12
171 0.11
172 0.07
173 0.07
174 0.08
175 0.08
176 0.07
177 0.1
178 0.09
179 0.12
180 0.12
181 0.12
182 0.12
183 0.14
184 0.13
185 0.12
186 0.13
187 0.13
188 0.16
189 0.18
190 0.21
191 0.19
192 0.19
193 0.18
194 0.18
195 0.19
196 0.18
197 0.19
198 0.25
199 0.33
200 0.36
201 0.39
202 0.4
203 0.4
204 0.43
205 0.5
206 0.42
207 0.34
208 0.32
209 0.3
210 0.29
211 0.27
212 0.2
213 0.12
214 0.1
215 0.1
216 0.08
217 0.07
218 0.07
219 0.06
220 0.06
221 0.06
222 0.09
223 0.09
224 0.11
225 0.18
226 0.19
227 0.2
228 0.22
229 0.22
230 0.21
231 0.25
232 0.27
233 0.25
234 0.25
235 0.25
236 0.23
237 0.22
238 0.21
239 0.17
240 0.13
241 0.11
242 0.1
243 0.09
244 0.08
245 0.09
246 0.09
247 0.11
248 0.17
249 0.2
250 0.23
251 0.26
252 0.34
253 0.41
254 0.51
255 0.59
256 0.61
257 0.65
258 0.63
259 0.67
260 0.69
261 0.68
262 0.68
263 0.62
264 0.57
265 0.48
266 0.47
267 0.4
268 0.3
269 0.24
270 0.15
271 0.14
272 0.13
273 0.17
274 0.17
275 0.18
276 0.16
277 0.21
278 0.22
279 0.21
280 0.25
281 0.21
282 0.22
283 0.22
284 0.24
285 0.2
286 0.18
287 0.18
288 0.14
289 0.13
290 0.14
291 0.15
292 0.16
293 0.16
294 0.16
295 0.16
296 0.15
297 0.15
298 0.13
299 0.12
300 0.1
301 0.09
302 0.09
303 0.09
304 0.09
305 0.09
306 0.08
307 0.08
308 0.08
309 0.06
310 0.06
311 0.06
312 0.06
313 0.06
314 0.07
315 0.07
316 0.06
317 0.06
318 0.07
319 0.07
320 0.08
321 0.08
322 0.07
323 0.07
324 0.08
325 0.11
326 0.11
327 0.1
328 0.1
329 0.09
330 0.12
331 0.13
332 0.12
333 0.09
334 0.09
335 0.09
336 0.1
337 0.1
338 0.08
339 0.1
340 0.14
341 0.18
342 0.19
343 0.21
344 0.24
345 0.25
346 0.27
347 0.26
348 0.26
349 0.26
350 0.27
351 0.28
352 0.31
353 0.32
354 0.3
355 0.29
356 0.27
357 0.28
358 0.31
359 0.33
360 0.28
361 0.26
362 0.24
363 0.24
364 0.23
365 0.18
366 0.15
367 0.1
368 0.1
369 0.1
370 0.1
371 0.1
372 0.1
373 0.1
374 0.11
375 0.1
376 0.09
377 0.09
378 0.1
379 0.09
380 0.09
381 0.08
382 0.1
383 0.15
384 0.15
385 0.15
386 0.2
387 0.2
388 0.21
389 0.29
390 0.28
391 0.24
392 0.25
393 0.26
394 0.21
395 0.2
396 0.19
397 0.11
398 0.08
399 0.09
400 0.09
401 0.12
402 0.12
403 0.12
404 0.18
405 0.2
406 0.23
407 0.26
408 0.32
409 0.31
410 0.38
411 0.4
412 0.36
413 0.36
414 0.43
415 0.45
416 0.42
417 0.44
418 0.39
419 0.38
420 0.38
421 0.37
422 0.28
423 0.23
424 0.22
425 0.18
426 0.21
427 0.22
428 0.21
429 0.19
430 0.2
431 0.22
432 0.23
433 0.23
434 0.2
435 0.19
436 0.19
437 0.18
438 0.18