FuNGI

Q0UNX4

Protein Details

Accession

Q0UNX4

Localization Confidence

Low

Confidence Score

5.4

NoLS Segment(s)

Position	Sequence	Protein Nature
11-32	LSKAADKKWKHRVNYTDKHNGN	Hydrophilic

NLS Segment(s)

Subcellular Location(s)

mito 15, cyto 6, pero 3, nucl 1, plas 1, cysk 1

Family & Domain DBs

InterPro	View protein in InterPro IPR036188 FAD/NAD-bd_sf IPR000960 Flavin_mOase IPR020946 Flavin_mOase-like
Gene Ontology	GO:0050660 F:flavin adenine dinucleotide binding GO:0004499 F:N,N-dimethylaniline monooxygenase activity GO:0050661 F:NADP binding
KEGG	pno:SNOG_06540 -
Pfam	View protein in Pfam PF00743 FMO-like

Amino Acid Sequences

MGCRVTGIEPLSKAADKKWKHRVNYTDKHNGNEQQTFDCSHIAICTGLHVEPNIPNLPGIENIKGEVFHSSSYKKRAQLTGRDVLIMGCGETAMDIAYEAIKSDAKSVTMCFRTGFLSFPKALSRFKVFGKQFKGGLPIDGLITNLFETAYVHRAIAASRFRWFVSDFVIKRVLWFLTGTQAGMNQHVGALPHDRLGRAFVFLNKSSKAMPYLNRPYQEKHPLGFLGNGYVDPPEDAQSKRWVDTCSFPSHIDAIGRVLFEPRPDRKDWRRLKDAEIRPDCVVYCTGYKQSFSWLDPSYPTASDASIRNIVAPEETSIAFIGFVRPGVGAIPPIAEQQAMWWTALITGRMALPTDPPHYHLLAKSSSRIQYGVDHSAYMSTLAKDFGGAPGLVELWKVHGFKVLLVYCFGASFVTFYRLLGPFRCKEAPGIARTELAETILRRGVLGNVFFGVSTSMH

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.3
2	0.37
3	0.39
4	0.48
5	0.57
6	0.62
7	0.66
8	0.74
9	0.77
10	0.79
11	0.82
12	0.82
13	0.81
14	0.76
15	0.73
16	0.71
17	0.67
18	0.62
19	0.58
20	0.51
21	0.44
22	0.43
23	0.41
24	0.35
25	0.29
26	0.23
27	0.18
28	0.16
29	0.13
30	0.12
31	0.1
32	0.1
33	0.11
34	0.11
35	0.12
36	0.12
37	0.13
38	0.15
39	0.2
40	0.19
41	0.18
42	0.17
43	0.17
44	0.18
45	0.19
46	0.21
47	0.18
48	0.17
49	0.18
50	0.19
51	0.18
52	0.17
53	0.16
54	0.14
55	0.13
56	0.17
57	0.2
58	0.25
59	0.32
60	0.38
61	0.39
62	0.44
63	0.51
64	0.55
65	0.61
66	0.63
67	0.63
68	0.58
69	0.54
70	0.48
71	0.39
72	0.33
73	0.23
74	0.15
75	0.07
76	0.06
77	0.05
78	0.05
79	0.05
80	0.03
81	0.03
82	0.03
83	0.04
84	0.04
85	0.04
86	0.05
87	0.06
88	0.07
89	0.08
90	0.11
91	0.12
92	0.12
93	0.13
94	0.15
95	0.21
96	0.22
97	0.22
98	0.19
99	0.2
100	0.21
101	0.2
102	0.21
103	0.16
104	0.19
105	0.19
106	0.2
107	0.24
108	0.24
109	0.26
110	0.27
111	0.3
112	0.28
113	0.3
114	0.39
115	0.38
116	0.43
117	0.47
118	0.46
119	0.43
120	0.41
121	0.44
122	0.35
123	0.32
124	0.25
125	0.2
126	0.17
127	0.15
128	0.14
129	0.08
130	0.08
131	0.07
132	0.06
133	0.05
134	0.04
135	0.06
136	0.07
137	0.09
138	0.09
139	0.09
140	0.1
141	0.1
142	0.11
143	0.15
144	0.17
145	0.16
146	0.18
147	0.19
148	0.19
149	0.2
150	0.21
151	0.16
152	0.18
153	0.25
154	0.23
155	0.25
156	0.28
157	0.26
158	0.26
159	0.27
160	0.21
161	0.14
162	0.14
163	0.11
164	0.12
165	0.12
166	0.12
167	0.1
168	0.12
169	0.11
170	0.12
171	0.11
172	0.07
173	0.07
174	0.08
175	0.08
176	0.07
177	0.1
178	0.09
179	0.12
180	0.12
181	0.12
182	0.12
183	0.14
184	0.13
185	0.12
186	0.13
187	0.13
188	0.16
189	0.18
190	0.21
191	0.19
192	0.19
193	0.18
194	0.18
195	0.19
196	0.18
197	0.19
198	0.25
199	0.33
200	0.36
201	0.39
202	0.4
203	0.4
204	0.43
205	0.5
206	0.42
207	0.34
208	0.32
209	0.3
210	0.29
211	0.27
212	0.2
213	0.12
214	0.1
215	0.1
216	0.08
217	0.07
218	0.07
219	0.06
220	0.06
221	0.06
222	0.09
223	0.09
224	0.11
225	0.18
226	0.19
227	0.2
228	0.22
229	0.22
230	0.21
231	0.25
232	0.27
233	0.25
234	0.25
235	0.25
236	0.23
237	0.22
238	0.21
239	0.17
240	0.13
241	0.11
242	0.1
243	0.09
244	0.08
245	0.09
246	0.09
247	0.11
248	0.17
249	0.2
250	0.23
251	0.26
252	0.34
253	0.41
254	0.51
255	0.59
256	0.61
257	0.65
258	0.63
259	0.67
260	0.69
261	0.68
262	0.68
263	0.62
264	0.57
265	0.48
266	0.47
267	0.4
268	0.3
269	0.24
270	0.15
271	0.14
272	0.13
273	0.17
274	0.17
275	0.18
276	0.16
277	0.21
278	0.22
279	0.21
280	0.25
281	0.21
282	0.22
283	0.22
284	0.24
285	0.2
286	0.18
287	0.18
288	0.14
289	0.13
290	0.14
291	0.15
292	0.16
293	0.16
294	0.16
295	0.16
296	0.15
297	0.15
298	0.13
299	0.12
300	0.1
301	0.09
302	0.09
303	0.09
304	0.09
305	0.09
306	0.08
307	0.08
308	0.08
309	0.06
310	0.06
311	0.06
312	0.06
313	0.06
314	0.07
315	0.07
316	0.06
317	0.06
318	0.07
319	0.07
320	0.08
321	0.08
322	0.07
323	0.07
324	0.08
325	0.11
326	0.11
327	0.1
328	0.1
329	0.09
330	0.12
331	0.13
332	0.12
333	0.09
334	0.09
335	0.09
336	0.1
337	0.1
338	0.08
339	0.1
340	0.14
341	0.18
342	0.19
343	0.21
344	0.24
345	0.25
346	0.27
347	0.26
348	0.26
349	0.26
350	0.27
351	0.28
352	0.31
353	0.32
354	0.3
355	0.29
356	0.27
357	0.28
358	0.31
359	0.33
360	0.28
361	0.26
362	0.24
363	0.24
364	0.23
365	0.18
366	0.15
367	0.1
368	0.1
369	0.1
370	0.1
371	0.1
372	0.1
373	0.1
374	0.11
375	0.1
376	0.09
377	0.09
378	0.1
379	0.09
380	0.09
381	0.08
382	0.1
383	0.15
384	0.15
385	0.15
386	0.2
387	0.2
388	0.21
389	0.29
390	0.28
391	0.24
392	0.25
393	0.26
394	0.21
395	0.2
396	0.19
397	0.11
398	0.08
399	0.09
400	0.09
401	0.12
402	0.12
403	0.12
404	0.18
405	0.2
406	0.23
407	0.26
408	0.32
409	0.31
410	0.38
411	0.4
412	0.36
413	0.36
414	0.43
415	0.45
416	0.42
417	0.44
418	0.39
419	0.38
420	0.38
421	0.37
422	0.28
423	0.23
424	0.22
425	0.18
426	0.21
427	0.22
428	0.21
429	0.19
430	0.2
431	0.22
432	0.23
433	0.23
434	0.2
435	0.19
436	0.19
437	0.18
438	0.18

Q0UNX4

3D AlphaFold-predicted Structure Viewer