Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

K5VD10

Protein Details
Accession K5VD10   
Localization Confidence Medium
Confidence Score 12.9
NoLS Segment(s)
PositionSequenceProtein Nature
77-98PAGSHKRHFSRGKKGKERLSADBasic
NLS Segment(s)
PositionSequence
82-93KRHFSRGKKGKE
Subcellular Location(s) nucl 19, cyto_nucl 13.5, cyto 6
Family & Domain DBs
KEGG pco:PHACADRAFT_246979  -  
Amino Acid Sequences MPPEASGKAVLQGVEGPPDYDQPATVPSRTSSETHTSSTESKSGIVKRAMERTADKLHRSKSSVTGASLSQSQPLLPAGSHKRHFSRGKKGKERLSADGDGASRSELLLHAQSSVHRA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.15
3 0.13
4 0.12
5 0.14
6 0.15
7 0.13
8 0.12
9 0.1
10 0.14
11 0.16
12 0.16
13 0.16
14 0.16
15 0.19
16 0.21
17 0.21
18 0.22
19 0.26
20 0.27
21 0.28
22 0.28
23 0.27
24 0.27
25 0.28
26 0.25
27 0.19
28 0.18
29 0.2
30 0.21
31 0.23
32 0.24
33 0.25
34 0.27
35 0.31
36 0.31
37 0.29
38 0.28
39 0.28
40 0.34
41 0.33
42 0.33
43 0.32
44 0.35
45 0.35
46 0.36
47 0.32
48 0.29
49 0.31
50 0.29
51 0.26
52 0.24
53 0.21
54 0.2
55 0.2
56 0.15
57 0.12
58 0.1
59 0.1
60 0.09
61 0.09
62 0.09
63 0.07
64 0.13
65 0.18
66 0.25
67 0.28
68 0.32
69 0.34
70 0.43
71 0.52
72 0.53
73 0.59
74 0.62
75 0.7
76 0.76
77 0.81
78 0.8
79 0.81
80 0.79
81 0.73
82 0.7
83 0.61
84 0.52
85 0.47
86 0.39
87 0.3
88 0.24
89 0.19
90 0.12
91 0.1
92 0.1
93 0.07
94 0.1
95 0.12
96 0.12
97 0.12
98 0.13