Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

K5VYK0

Protein Details
Accession K5VYK0    Localization Confidence Medium Confidence Score 10.7
NoLS Segment(s)
PositionSequenceProtein Nature
269-295RPESKVKKVLAKRKADPKRGKHFDELABasic
NLS Segment(s)
PositionSequence
273-289KVKKVLAKRKADPKRGK
Subcellular Location(s) mito 17, nucl 7, cyto 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR014729  Rossmann-like_a/b/a_fold  
IPR006016  UspA  
KEGG pco:PHACADRAFT_253913  -  
Pfam View protein in Pfam  
PF00582  Usp  
CDD cd00293  USP_Like  
Amino Acid Sequences MSRSPEYPHYIPLPPPPLRSAMKHTAPRPSTPSHASNSSPFRLSQSPQMGPSSSRPSFSQAASSGFLALGSASAPQSPRGGLLPLPAVVQQGYTPKVGFDTFEDPQASMFSYTLHVQSEGYSRTKNTRVFLCASSADESGMQALEWALDSLVQDGDEFIVFRGVDDGDLNREQAAYREEARELMRQVQEKASEYDADRKVSIIIEFIAGSVTSSIDRLIALYRPDSLVVGTRGQRGIMQTWGAALGGSSVGSVSKYCLSHSPIPVIVVRPESKVKKVLAKRKADPKRGKHFDELAKTGRQSVPMYSALTR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.44
2 0.46
3 0.43
4 0.45
5 0.45
6 0.47
7 0.47
8 0.47
9 0.52
10 0.57
11 0.58
12 0.62
13 0.61
14 0.62
15 0.59
16 0.54
17 0.52
18 0.5
19 0.51
20 0.46
21 0.47
22 0.45
23 0.46
24 0.48
25 0.45
26 0.4
27 0.36
28 0.36
29 0.36
30 0.36
31 0.37
32 0.38
33 0.38
34 0.39
35 0.41
36 0.37
37 0.35
38 0.39
39 0.39
40 0.32
41 0.32
42 0.3
43 0.33
44 0.35
45 0.33
46 0.32
47 0.25
48 0.27
49 0.26
50 0.25
51 0.2
52 0.17
53 0.16
54 0.11
55 0.09
56 0.06
57 0.04
58 0.05
59 0.05
60 0.06
61 0.07
62 0.08
63 0.09
64 0.1
65 0.1
66 0.11
67 0.12
68 0.11
69 0.12
70 0.13
71 0.12
72 0.13
73 0.12
74 0.11
75 0.1
76 0.1
77 0.09
78 0.11
79 0.12
80 0.13
81 0.12
82 0.11
83 0.13
84 0.13
85 0.12
86 0.12
87 0.16
88 0.16
89 0.19
90 0.19
91 0.18
92 0.18
93 0.18
94 0.15
95 0.1
96 0.1
97 0.07
98 0.08
99 0.09
100 0.1
101 0.1
102 0.09
103 0.09
104 0.1
105 0.13
106 0.14
107 0.14
108 0.14
109 0.15
110 0.2
111 0.25
112 0.27
113 0.27
114 0.27
115 0.29
116 0.31
117 0.31
118 0.29
119 0.23
120 0.22
121 0.21
122 0.18
123 0.15
124 0.12
125 0.11
126 0.09
127 0.08
128 0.06
129 0.04
130 0.03
131 0.03
132 0.03
133 0.03
134 0.03
135 0.03
136 0.03
137 0.04
138 0.04
139 0.04
140 0.04
141 0.04
142 0.04
143 0.04
144 0.04
145 0.03
146 0.05
147 0.04
148 0.04
149 0.05
150 0.05
151 0.05
152 0.06
153 0.06
154 0.08
155 0.08
156 0.09
157 0.08
158 0.08
159 0.08
160 0.09
161 0.1
162 0.09
163 0.11
164 0.12
165 0.12
166 0.14
167 0.16
168 0.17
169 0.17
170 0.2
171 0.22
172 0.22
173 0.24
174 0.24
175 0.24
176 0.23
177 0.24
178 0.2
179 0.19
180 0.18
181 0.25
182 0.25
183 0.25
184 0.23
185 0.21
186 0.2
187 0.19
188 0.18
189 0.1
190 0.08
191 0.07
192 0.07
193 0.07
194 0.06
195 0.05
196 0.05
197 0.05
198 0.05
199 0.04
200 0.05
201 0.05
202 0.05
203 0.05
204 0.05
205 0.06
206 0.08
207 0.09
208 0.1
209 0.11
210 0.11
211 0.12
212 0.11
213 0.1
214 0.12
215 0.12
216 0.16
217 0.17
218 0.19
219 0.19
220 0.2
221 0.21
222 0.19
223 0.19
224 0.18
225 0.16
226 0.13
227 0.13
228 0.13
229 0.12
230 0.09
231 0.07
232 0.05
233 0.04
234 0.04
235 0.04
236 0.04
237 0.04
238 0.05
239 0.05
240 0.07
241 0.11
242 0.11
243 0.13
244 0.18
245 0.24
246 0.3
247 0.33
248 0.35
249 0.32
250 0.34
251 0.34
252 0.32
253 0.28
254 0.27
255 0.26
256 0.26
257 0.33
258 0.35
259 0.37
260 0.41
261 0.42
262 0.47
263 0.55
264 0.61
265 0.63
266 0.68
267 0.72
268 0.78
269 0.84
270 0.85
271 0.86
272 0.86
273 0.88
274 0.87
275 0.84
276 0.81
277 0.79
278 0.77
279 0.75
280 0.71
281 0.64
282 0.61
283 0.56
284 0.54
285 0.47
286 0.42
287 0.36
288 0.33
289 0.33
290 0.3