Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

K5WIG6

Protein Details
Accession K5WIG6    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
73-92SSTPRCKSSRRTVAVKKACAHydrophilic
NLS Segment(s)
Subcellular Location(s) plas 14, extr 4, mito 3, vacu 2, cyto_mito 2
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
KEGG pco:PHACADRAFT_248992  -  
Amino Acid Sequences MGISAEREVHLATVLGLFYAVIYVFTCFCLFTLSIIASVDRACARASYLAIKQYQCLTVHDIPRPIFIVGVASSTPRCKSSRRTVAVKKACAVHRRRKCCW
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.07
2 0.06
3 0.06
4 0.05
5 0.04
6 0.05
7 0.04
8 0.04
9 0.04
10 0.05
11 0.05
12 0.07
13 0.07
14 0.07
15 0.07
16 0.09
17 0.08
18 0.08
19 0.1
20 0.09
21 0.09
22 0.1
23 0.09
24 0.08
25 0.07
26 0.08
27 0.06
28 0.07
29 0.07
30 0.06
31 0.07
32 0.08
33 0.09
34 0.11
35 0.12
36 0.14
37 0.17
38 0.17
39 0.17
40 0.17
41 0.19
42 0.17
43 0.17
44 0.2
45 0.22
46 0.26
47 0.27
48 0.29
49 0.27
50 0.27
51 0.27
52 0.21
53 0.16
54 0.12
55 0.12
56 0.09
57 0.1
58 0.09
59 0.08
60 0.1
61 0.12
62 0.14
63 0.15
64 0.17
65 0.21
66 0.29
67 0.39
68 0.49
69 0.53
70 0.62
71 0.68
72 0.77
73 0.81
74 0.76
75 0.69
76 0.66
77 0.66
78 0.66
79 0.65
80 0.65
81 0.67