Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

K5WCF5

Protein Details
Accession K5WCF5    Localization Confidence Medium Confidence Score 11.2
NoLS Segment(s)
PositionSequenceProtein Nature
41-65KGTKGGSKSPKKGRRKGKAKGEERVBasic
NLS Segment(s)
PositionSequence
26-61RVRAKEREENSKQKGKGTKGGSKSPKKGRRKGKAKG
Subcellular Location(s) nucl 14, cyto_nucl 12.333, cyto 9.5, mito_nucl 8.333
Family & Domain DBs
InterPro View protein in InterPro  
IPR020795  ORC3  
IPR040855  ORC_WH_C  
Gene Ontology GO:0005664  C:nuclear origin of replication recognition complex  
GO:0003677  F:DNA binding  
GO:0006260  P:DNA replication  
KEGG pco:PHACADRAFT_253953  -  
Pfam View protein in Pfam  
PF18137  ORC_WH_C  
Amino Acid Sequences MEAPKKVNAYDWYESFAQVLETQRERVRAKEREENSKQKGKGTKGGSKSPKKGRRKGKAKGEERVEAEDEGHEVDEVDEEWQAELQARFIRALHELDYMGFVKHTGRKADHIVKTIYEVYE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.34
2 0.29
3 0.24
4 0.17
5 0.15
6 0.17
7 0.18
8 0.2
9 0.23
10 0.25
11 0.32
12 0.32
13 0.35
14 0.41
15 0.43
16 0.48
17 0.54
18 0.56
19 0.6
20 0.66
21 0.69
22 0.67
23 0.68
24 0.62
25 0.59
26 0.62
27 0.55
28 0.55
29 0.52
30 0.53
31 0.5
32 0.58
33 0.61
34 0.62
35 0.67
36 0.69
37 0.72
38 0.74
39 0.78
40 0.8
41 0.81
42 0.83
43 0.84
44 0.84
45 0.85
46 0.81
47 0.79
48 0.73
49 0.66
50 0.58
51 0.51
52 0.41
53 0.31
54 0.25
55 0.18
56 0.14
57 0.1
58 0.08
59 0.06
60 0.05
61 0.04
62 0.04
63 0.05
64 0.05
65 0.05
66 0.05
67 0.05
68 0.05
69 0.05
70 0.07
71 0.07
72 0.09
73 0.1
74 0.11
75 0.12
76 0.12
77 0.13
78 0.13
79 0.15
80 0.15
81 0.14
82 0.14
83 0.13
84 0.16
85 0.15
86 0.13
87 0.11
88 0.1
89 0.12
90 0.17
91 0.22
92 0.25
93 0.27
94 0.31
95 0.4
96 0.5
97 0.51
98 0.5
99 0.48
100 0.44
101 0.45