Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

K5WPJ0

Protein Details
Accession K5WPJ0    Localization Confidence High Confidence Score 16.8
NoLS Segment(s)
PositionSequenceProtein Nature
84-111KQGPSPARKGSPRRQPPRWRASRSGPLLHydrophilic
NLS Segment(s)
PositionSequence
44-106RSRSRPRAPAHPSPPLQFQDRHRKRSRVLPQAPKALSRNIKQGPSPARKGSPRRQPPRWRASR
Subcellular Location(s) nucl 22, cyto 3
Family & Domain DBs
KEGG pco:PHACADRAFT_260503  -  
Amino Acid Sequences MSVFNPKILDASIRDITTDLADEQKVDVLIYAMQHLKLDRSVPRSRSRPRAPAHPSPPLQFQDRHRKRSRVLPQAPKALSRNIKQGPSPARKGSPRRQPPRWRASRSGPLLACRPWSVPD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.22
3 0.22
4 0.19
5 0.18
6 0.12
7 0.11
8 0.11
9 0.11
10 0.11
11 0.12
12 0.11
13 0.09
14 0.09
15 0.07
16 0.07
17 0.07
18 0.09
19 0.09
20 0.09
21 0.1
22 0.1
23 0.11
24 0.11
25 0.14
26 0.16
27 0.22
28 0.28
29 0.32
30 0.4
31 0.47
32 0.52
33 0.59
34 0.62
35 0.63
36 0.61
37 0.66
38 0.65
39 0.66
40 0.64
41 0.62
42 0.57
43 0.51
44 0.52
45 0.44
46 0.4
47 0.34
48 0.36
49 0.4
50 0.45
51 0.52
52 0.54
53 0.56
54 0.56
55 0.62
56 0.65
57 0.65
58 0.67
59 0.68
60 0.67
61 0.71
62 0.69
63 0.63
64 0.55
65 0.51
66 0.48
67 0.4
68 0.44
69 0.4
70 0.41
71 0.38
72 0.44
73 0.46
74 0.48
75 0.51
76 0.47
77 0.49
78 0.55
79 0.63
80 0.65
81 0.67
82 0.7
83 0.74
84 0.8
85 0.85
86 0.87
87 0.89
88 0.9
89 0.87
90 0.83
91 0.83
92 0.83
93 0.77
94 0.75
95 0.67
96 0.61
97 0.58
98 0.53
99 0.48
100 0.4