Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

K5WBF7

Protein Details
Accession K5WBF7    Localization Confidence Medium Confidence Score 13.8
NoLS Segment(s)
PositionSequenceProtein Nature
47-72PPQHAQVTKERKRANRKRAEIQSPETHydrophilic
NLS Segment(s)
PositionSequence
57-64RKRANRKR
Subcellular Location(s) nucl 22, cyto_nucl 13, mito 3
Family & Domain DBs
KEGG pco:PHACADRAFT_253733  -  
Amino Acid Sequences MSRTAVRKHRTKSTAKEASSAQEPQPLDRSKARVQQPKAQDTASEPPPQHAQVTKERKRANRKRAEIQSPETPVS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.76
2 0.68
3 0.65
4 0.56
5 0.52
6 0.47
7 0.41
8 0.31
9 0.27
10 0.26
11 0.25
12 0.31
13 0.29
14 0.28
15 0.29
16 0.33
17 0.33
18 0.4
19 0.47
20 0.48
21 0.5
22 0.54
23 0.57
24 0.55
25 0.51
26 0.44
27 0.36
28 0.32
29 0.33
30 0.29
31 0.27
32 0.24
33 0.24
34 0.27
35 0.27
36 0.25
37 0.23
38 0.24
39 0.3
40 0.41
41 0.46
42 0.52
43 0.58
44 0.65
45 0.74
46 0.8
47 0.81
48 0.81
49 0.81
50 0.83
51 0.87
52 0.87
53 0.83
54 0.79
55 0.76