Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

K5WAY8

Protein Details
Accession K5WAY8   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
11-40KENIKPLREKYPKVRFWRKNMYKQQDGQPGHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 10.5, cyto_nucl 9, cyto 6.5, pero 6, mito 3
Family & Domain DBs
KEGG pco:PHACADRAFT_196208  -  
Amino Acid Sequences MQTAMGVPGPKENIKPLREKYPKVRFWRKNMYKQQDGQPGQSNPMREETPRQKSYKKLRFLENDQGVPYTIGEIAVVCETMKRAFLDLDSSHKVAPPATWQGHALDCHCKGVFSALYKAHPDIEYCADDWKANQIAIERYSHYRQHHPWPAAWPAPVRRIKEEPQQIVSEIKDDHADGDPSCSPGKPKLAADVENMDPAMAPLPDTTQKRAAPTSAED
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.39
2 0.48
3 0.48
4 0.56
5 0.62
6 0.67
7 0.69
8 0.72
9 0.76
10 0.78
11 0.84
12 0.81
13 0.83
14 0.87
15 0.86
16 0.86
17 0.89
18 0.87
19 0.84
20 0.82
21 0.81
22 0.8
23 0.72
24 0.66
25 0.63
26 0.55
27 0.52
28 0.49
29 0.42
30 0.33
31 0.34
32 0.31
33 0.24
34 0.33
35 0.37
36 0.45
37 0.49
38 0.52
39 0.53
40 0.61
41 0.7
42 0.7
43 0.69
44 0.65
45 0.67
46 0.7
47 0.73
48 0.74
49 0.67
50 0.6
51 0.51
52 0.46
53 0.38
54 0.3
55 0.23
56 0.14
57 0.09
58 0.07
59 0.06
60 0.05
61 0.05
62 0.05
63 0.05
64 0.04
65 0.04
66 0.05
67 0.06
68 0.07
69 0.07
70 0.07
71 0.08
72 0.08
73 0.12
74 0.12
75 0.17
76 0.18
77 0.19
78 0.18
79 0.19
80 0.19
81 0.15
82 0.14
83 0.13
84 0.16
85 0.17
86 0.17
87 0.17
88 0.18
89 0.19
90 0.2
91 0.17
92 0.16
93 0.15
94 0.16
95 0.16
96 0.14
97 0.12
98 0.14
99 0.14
100 0.11
101 0.15
102 0.14
103 0.16
104 0.17
105 0.17
106 0.17
107 0.15
108 0.14
109 0.12
110 0.14
111 0.14
112 0.13
113 0.14
114 0.13
115 0.13
116 0.13
117 0.14
118 0.12
119 0.11
120 0.12
121 0.12
122 0.14
123 0.15
124 0.17
125 0.15
126 0.18
127 0.22
128 0.26
129 0.28
130 0.33
131 0.36
132 0.44
133 0.51
134 0.49
135 0.48
136 0.47
137 0.49
138 0.44
139 0.41
140 0.36
141 0.31
142 0.38
143 0.41
144 0.4
145 0.4
146 0.43
147 0.46
148 0.51
149 0.56
150 0.52
151 0.5
152 0.48
153 0.44
154 0.41
155 0.36
156 0.29
157 0.2
158 0.17
159 0.14
160 0.13
161 0.14
162 0.14
163 0.15
164 0.12
165 0.16
166 0.16
167 0.18
168 0.18
169 0.17
170 0.18
171 0.22
172 0.27
173 0.27
174 0.27
175 0.34
176 0.37
177 0.39
178 0.4
179 0.39
180 0.35
181 0.33
182 0.31
183 0.22
184 0.18
185 0.16
186 0.14
187 0.09
188 0.08
189 0.07
190 0.12
191 0.19
192 0.22
193 0.27
194 0.32
195 0.35
196 0.39
197 0.41
198 0.39