Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

K5VHJ1

Protein Details
Accession K5VHJ1    Localization Confidence Medium Confidence Score 10.9
NoLS Segment(s)
PositionSequenceProtein Nature
46-69LRTPMSRPTRRTRGPRPRRVTTLTHydrophilic
NLS Segment(s)
PositionSequence
52-63RPTRRTRGPRPR
Subcellular Location(s) mito 14, nucl 9.5, cyto_nucl 6.5, cyto 2.5
Family & Domain DBs
KEGG pco:PHACADRAFT_264147  -  
Amino Acid Sequences MDQVHTQPRRRVPAVTAASTAFNNLSALSTRSPPRPSPLREGHLALRTPMSRPTRRTRGPRPRRVTTLTMASPAPMG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.52
2 0.47
3 0.41
4 0.33
5 0.33
6 0.29
7 0.27
8 0.17
9 0.12
10 0.1
11 0.08
12 0.08
13 0.07
14 0.09
15 0.1
16 0.13
17 0.15
18 0.19
19 0.23
20 0.23
21 0.28
22 0.34
23 0.36
24 0.41
25 0.44
26 0.42
27 0.41
28 0.42
29 0.4
30 0.37
31 0.33
32 0.26
33 0.23
34 0.21
35 0.2
36 0.25
37 0.29
38 0.3
39 0.36
40 0.45
41 0.52
42 0.59
43 0.68
44 0.72
45 0.76
46 0.81
47 0.86
48 0.86
49 0.84
50 0.82
51 0.79
52 0.73
53 0.67
54 0.64
55 0.55
56 0.49
57 0.41