Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

K5ULQ4

Protein Details
Accession K5ULQ4    Localization Confidence Low Confidence Score 7.8
NoLS Segment(s)
PositionSequenceProtein Nature
3-25SSPGPGPCRRKRGGRAWHREYFAHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 10, nucl 7, cyto 6, plas 2
Family & Domain DBs
KEGG pco:PHACADRAFT_213511  -  
Amino Acid Sequences MLSSPGPGPCRRKRGGRAWHREYFADHVRYESGDPCAMVRAGQRNARVKVWCKRCLEARVEDVVRVETQQYERGELAAVRERDLVVAELWNATDAGWIPCDTSRCLVHLRDCELQPPSVRERARSQKEEQNQARRVPDNASPPDVPSLPEANGVVTERTASMSVSLALPPVALPVVVHPVVLVYPTGYFSALQMQTTP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.75
2 0.79
3 0.81
4 0.83
5 0.82
6 0.83
7 0.76
8 0.69
9 0.61
10 0.57
11 0.54
12 0.48
13 0.4
14 0.34
15 0.32
16 0.32
17 0.3
18 0.25
19 0.2
20 0.17
21 0.17
22 0.15
23 0.16
24 0.15
25 0.14
26 0.16
27 0.21
28 0.25
29 0.29
30 0.36
31 0.41
32 0.44
33 0.48
34 0.49
35 0.49
36 0.53
37 0.58
38 0.59
39 0.55
40 0.56
41 0.59
42 0.59
43 0.57
44 0.52
45 0.47
46 0.46
47 0.43
48 0.39
49 0.33
50 0.28
51 0.23
52 0.18
53 0.15
54 0.11
55 0.11
56 0.16
57 0.16
58 0.17
59 0.17
60 0.16
61 0.16
62 0.14
63 0.16
64 0.16
65 0.16
66 0.15
67 0.15
68 0.15
69 0.15
70 0.15
71 0.13
72 0.07
73 0.07
74 0.06
75 0.06
76 0.05
77 0.05
78 0.05
79 0.04
80 0.04
81 0.05
82 0.05
83 0.05
84 0.06
85 0.06
86 0.07
87 0.09
88 0.09
89 0.1
90 0.1
91 0.12
92 0.14
93 0.15
94 0.19
95 0.2
96 0.24
97 0.25
98 0.25
99 0.26
100 0.25
101 0.25
102 0.22
103 0.23
104 0.22
105 0.25
106 0.25
107 0.26
108 0.32
109 0.41
110 0.47
111 0.49
112 0.51
113 0.52
114 0.58
115 0.65
116 0.65
117 0.64
118 0.61
119 0.6
120 0.6
121 0.53
122 0.48
123 0.41
124 0.38
125 0.37
126 0.35
127 0.35
128 0.31
129 0.31
130 0.32
131 0.29
132 0.25
133 0.2
134 0.2
135 0.16
136 0.17
137 0.16
138 0.13
139 0.14
140 0.14
141 0.11
142 0.09
143 0.09
144 0.08
145 0.09
146 0.09
147 0.08
148 0.08
149 0.08
150 0.09
151 0.09
152 0.09
153 0.08
154 0.08
155 0.08
156 0.07
157 0.07
158 0.06
159 0.05
160 0.05
161 0.06
162 0.12
163 0.12
164 0.12
165 0.11
166 0.11
167 0.11
168 0.12
169 0.1
170 0.06
171 0.06
172 0.08
173 0.09
174 0.09
175 0.09
176 0.09
177 0.18
178 0.18