Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

K5XDA6

Protein Details
Accession K5XDA6   
Localization Confidence Medium
Confidence Score 11.5
NoLS Segment(s)
PositionSequenceProtein Nature
1-45MAKTTIVKKRTKPFKRHQSDRYKSVKEAWRKPKGIDNRVRRRFKGBasic
NLS Segment(s)
PositionSequence
8-46KKRTKPFKRHQSDRYKSVKEAWRKPKGIDNRVRRRFKGQ
Subcellular Location(s) nucl 13.5, mito_nucl 12, mito 9.5, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR001515  Ribosomal_L32e  
IPR036351  Ribosomal_L32e_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
KEGG pco:PHACADRAFT_247298  -  
Pfam View protein in Pfam  
PF01655  Ribosomal_L32e  
CDD cd00513  Ribosomal_L32_L32e  
Amino Acid Sequences MAKTTIVKKRTKPFKRHQSDRYKSVKEAWRKPKGIDNRVRRRFKGQLSMPKIGYGSNKKTRHLLPNGLKKFLVSNVRELDLLLMHNKTFAAEIAHNVSSRNRIIIIERAKVLGVKVTNPAARLRSEE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.86
2 0.89
3 0.91
4 0.91
5 0.91
6 0.89
7 0.88
8 0.86
9 0.79
10 0.71
11 0.69
12 0.67
13 0.66
14 0.68
15 0.69
16 0.69
17 0.67
18 0.67
19 0.67
20 0.69
21 0.7
22 0.69
23 0.69
24 0.71
25 0.79
26 0.83
27 0.76
28 0.73
29 0.71
30 0.66
31 0.65
32 0.62
33 0.62
34 0.62
35 0.64
36 0.57
37 0.5
38 0.45
39 0.36
40 0.34
41 0.3
42 0.31
43 0.36
44 0.39
45 0.39
46 0.43
47 0.45
48 0.47
49 0.45
50 0.47
51 0.45
52 0.53
53 0.54
54 0.52
55 0.47
56 0.4
57 0.36
58 0.32
59 0.31
60 0.22
61 0.24
62 0.25
63 0.26
64 0.25
65 0.24
66 0.2
67 0.13
68 0.13
69 0.1
70 0.09
71 0.08
72 0.08
73 0.08
74 0.08
75 0.08
76 0.07
77 0.09
78 0.09
79 0.11
80 0.15
81 0.16
82 0.16
83 0.17
84 0.18
85 0.19
86 0.19
87 0.18
88 0.15
89 0.15
90 0.18
91 0.25
92 0.28
93 0.28
94 0.28
95 0.28
96 0.27
97 0.27
98 0.25
99 0.22
100 0.18
101 0.16
102 0.2
103 0.25
104 0.26
105 0.27
106 0.31
107 0.28