Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

K5URA5

Protein Details
Accession K5URA5    Localization Confidence Low Confidence Score 8.7
NoLS Segment(s)
PositionSequenceProtein Nature
61-82RSATCQKSDRPRKLSKQPQRGEHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 14, cyto_nucl 11, mito 7, cyto 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR016193  Cytidine_deaminase-like  
Gene Ontology GO:0003824  F:catalytic activity  
GO:0006139  P:nucleobase-containing compound metabolic process  
KEGG pco:PHACADRAFT_260733  -  
Amino Acid Sequences MVKGGKVISTGYNHHRPHYDGGELGTRGLRKPVSMHAEMHAIYSCIGMSPSFKTQVQAMERSATCQKSDRPRKLSKQPQRGEQGLCRFGDCTLPDLHSTINAYELRHVSV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.41
2 0.43
3 0.42
4 0.44
5 0.43
6 0.37
7 0.28
8 0.29
9 0.3
10 0.27
11 0.25
12 0.21
13 0.18
14 0.17
15 0.2
16 0.18
17 0.14
18 0.16
19 0.22
20 0.26
21 0.27
22 0.28
23 0.26
24 0.28
25 0.27
26 0.26
27 0.19
28 0.12
29 0.1
30 0.09
31 0.08
32 0.05
33 0.05
34 0.05
35 0.06
36 0.08
37 0.09
38 0.12
39 0.12
40 0.12
41 0.13
42 0.18
43 0.19
44 0.19
45 0.18
46 0.2
47 0.19
48 0.22
49 0.25
50 0.2
51 0.19
52 0.2
53 0.25
54 0.33
55 0.43
56 0.49
57 0.53
58 0.61
59 0.69
60 0.77
61 0.82
62 0.81
63 0.82
64 0.78
65 0.78
66 0.77
67 0.73
68 0.66
69 0.63
70 0.6
71 0.53
72 0.49
73 0.41
74 0.34
75 0.31
76 0.31
77 0.24
78 0.19
79 0.17
80 0.18
81 0.19
82 0.19
83 0.19
84 0.16
85 0.17
86 0.15
87 0.18
88 0.18
89 0.18
90 0.22