Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

K5VMY9

Protein Details
Accession K5VMY9    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
102-123DREYLSQRVRTRTRRREIAELAHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 19.5, cyto_mito 13.833, cyto 7
Family & Domain DBs
KEGG pco:PHACADRAFT_203296  -  
Amino Acid Sequences MTTITPKVEAAIASLRSSGTQAPNTSGPTIVLSTVYTRYTPKSVEALQWALEKGFIVDVDIETNLRAGEGAWEDLEEFLVKAIPTSHRGKIILSNILPAPDDREYLSQRVRTRTRRREIAELAS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.17
3 0.16
4 0.17
5 0.18
6 0.17
7 0.2
8 0.2
9 0.23
10 0.26
11 0.27
12 0.27
13 0.23
14 0.19
15 0.17
16 0.16
17 0.13
18 0.11
19 0.09
20 0.1
21 0.12
22 0.12
23 0.11
24 0.12
25 0.15
26 0.16
27 0.17
28 0.17
29 0.19
30 0.2
31 0.21
32 0.22
33 0.21
34 0.2
35 0.21
36 0.19
37 0.14
38 0.13
39 0.11
40 0.08
41 0.07
42 0.05
43 0.04
44 0.04
45 0.04
46 0.05
47 0.05
48 0.05
49 0.04
50 0.05
51 0.04
52 0.04
53 0.04
54 0.03
55 0.04
56 0.05
57 0.05
58 0.05
59 0.05
60 0.06
61 0.06
62 0.06
63 0.05
64 0.04
65 0.04
66 0.05
67 0.05
68 0.05
69 0.07
70 0.09
71 0.13
72 0.18
73 0.2
74 0.22
75 0.23
76 0.24
77 0.28
78 0.3
79 0.31
80 0.27
81 0.28
82 0.25
83 0.26
84 0.25
85 0.19
86 0.2
87 0.15
88 0.16
89 0.15
90 0.2
91 0.22
92 0.27
93 0.33
94 0.34
95 0.38
96 0.46
97 0.54
98 0.59
99 0.67
100 0.73
101 0.77
102 0.81
103 0.81
104 0.82