Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

K5V2R4

Protein Details
Accession K5V2R4    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
11-30TYYIPPRKTVKSRHSMNNGHHydrophilic
NLS Segment(s)
Subcellular Location(s) plas 21, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR037997  Dgk1-like  
Gene Ontology GO:0016020  C:membrane  
GO:0004143  F:diacylglycerol kinase activity  
KEGG pco:PHACADRAFT_254155  -  
Amino Acid Sequences MSTHTRISPQTYYIPPRKTVKSRHSMNNGHANGHAQHKTSQIPVAQEASREESSRKASAALSTANIRLPHTSPVDWEIPRKFLHSSIGFLTLYLYLAHGSSRTVVKALGMALTIIVPADVLRLSFPGFERIYEKALGFLMRDSEKKTTNGVIWYIIGVLWVLSAYPLDIAVVSILILSWADTAASTIGRAWGRFTPPLPRRLFGLPLAPRKSLAGFIAGSITGAAIVAGFWTFLGPLGELEPVWTFEGGVEGTGSFSGWFGLSAISVVSGLVSGVSEALDLGSLDDNLTLPILSGGCIWGLFKCLKYLA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.55
2 0.56
3 0.6
4 0.65
5 0.67
6 0.7
7 0.71
8 0.72
9 0.76
10 0.79
11 0.82
12 0.79
13 0.78
14 0.78
15 0.69
16 0.61
17 0.53
18 0.47
19 0.4
20 0.41
21 0.36
22 0.28
23 0.29
24 0.31
25 0.32
26 0.31
27 0.32
28 0.28
29 0.27
30 0.28
31 0.3
32 0.27
33 0.26
34 0.26
35 0.28
36 0.27
37 0.25
38 0.24
39 0.25
40 0.29
41 0.29
42 0.27
43 0.22
44 0.22
45 0.22
46 0.24
47 0.21
48 0.18
49 0.18
50 0.19
51 0.21
52 0.2
53 0.19
54 0.19
55 0.19
56 0.22
57 0.23
58 0.23
59 0.21
60 0.25
61 0.29
62 0.28
63 0.32
64 0.29
65 0.29
66 0.29
67 0.29
68 0.26
69 0.22
70 0.28
71 0.24
72 0.24
73 0.22
74 0.25
75 0.23
76 0.21
77 0.21
78 0.14
79 0.13
80 0.1
81 0.09
82 0.06
83 0.06
84 0.06
85 0.06
86 0.06
87 0.07
88 0.08
89 0.08
90 0.09
91 0.08
92 0.08
93 0.09
94 0.09
95 0.07
96 0.06
97 0.06
98 0.05
99 0.05
100 0.05
101 0.04
102 0.03
103 0.03
104 0.02
105 0.03
106 0.03
107 0.03
108 0.03
109 0.04
110 0.05
111 0.06
112 0.07
113 0.11
114 0.12
115 0.12
116 0.15
117 0.16
118 0.17
119 0.17
120 0.17
121 0.12
122 0.13
123 0.12
124 0.1
125 0.09
126 0.09
127 0.1
128 0.11
129 0.13
130 0.15
131 0.17
132 0.18
133 0.19
134 0.18
135 0.18
136 0.19
137 0.17
138 0.14
139 0.12
140 0.11
141 0.09
142 0.08
143 0.06
144 0.04
145 0.03
146 0.03
147 0.02
148 0.02
149 0.02
150 0.02
151 0.02
152 0.02
153 0.02
154 0.02
155 0.02
156 0.03
157 0.02
158 0.03
159 0.02
160 0.02
161 0.02
162 0.02
163 0.02
164 0.02
165 0.02
166 0.02
167 0.03
168 0.03
169 0.03
170 0.04
171 0.04
172 0.04
173 0.04
174 0.08
175 0.09
176 0.09
177 0.11
178 0.13
179 0.16
180 0.18
181 0.19
182 0.25
183 0.29
184 0.38
185 0.38
186 0.36
187 0.37
188 0.37
189 0.39
190 0.3
191 0.34
192 0.32
193 0.38
194 0.41
195 0.38
196 0.36
197 0.34
198 0.33
199 0.27
200 0.21
201 0.15
202 0.12
203 0.11
204 0.12
205 0.11
206 0.1
207 0.08
208 0.07
209 0.04
210 0.04
211 0.03
212 0.02
213 0.02
214 0.02
215 0.03
216 0.03
217 0.03
218 0.03
219 0.03
220 0.04
221 0.05
222 0.05
223 0.05
224 0.06
225 0.07
226 0.07
227 0.08
228 0.08
229 0.09
230 0.1
231 0.09
232 0.08
233 0.08
234 0.09
235 0.08
236 0.08
237 0.06
238 0.06
239 0.06
240 0.06
241 0.06
242 0.05
243 0.05
244 0.05
245 0.05
246 0.05
247 0.05
248 0.05
249 0.05
250 0.05
251 0.05
252 0.05
253 0.05
254 0.04
255 0.04
256 0.04
257 0.03
258 0.03
259 0.03
260 0.03
261 0.03
262 0.04
263 0.04
264 0.04
265 0.04
266 0.04
267 0.04
268 0.05
269 0.06
270 0.06
271 0.07
272 0.07
273 0.07
274 0.07
275 0.08
276 0.06
277 0.05
278 0.07
279 0.07
280 0.07
281 0.07
282 0.07
283 0.07
284 0.08
285 0.08
286 0.07
287 0.11
288 0.13
289 0.13