Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

K5WNJ5

Protein Details
Accession K5WNJ5    Localization Confidence Medium Confidence Score 12.6
NoLS Segment(s)
PositionSequenceProtein Nature
12-31LAVPKKKTSHSRKSMRSANKHydrophilic
NLS Segment(s)
PositionSequence
18-18K
22-24SRK
Subcellular Location(s) mito 20, nucl 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR002677  Ribosomal_L32p  
IPR011332  Ribosomal_zn-bd  
Gene Ontology GO:0015934  C:large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
KEGG pco:PHACADRAFT_47378  -  
Pfam View protein in Pfam  
PF01783  Ribosomal_L32p  
Amino Acid Sequences ETLRELIPPFLLAVPKKKTSHSRKSMRSANKGLKDKENLVHCPGCGSAKLAHHLCPTCYSNLSREWKAKAR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.29
2 0.35
3 0.36
4 0.41
5 0.5
6 0.55
7 0.64
8 0.66
9 0.71
10 0.72
11 0.79
12 0.82
13 0.8
14 0.78
15 0.75
16 0.73
17 0.71
18 0.7
19 0.64
20 0.6
21 0.54
22 0.49
23 0.45
24 0.41
25 0.35
26 0.33
27 0.31
28 0.26
29 0.24
30 0.22
31 0.18
32 0.14
33 0.14
34 0.14
35 0.15
36 0.21
37 0.22
38 0.24
39 0.28
40 0.29
41 0.29
42 0.3
43 0.3
44 0.28
45 0.3
46 0.29
47 0.27
48 0.34
49 0.4
50 0.41
51 0.44