Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

K5WAB0

Protein Details
Accession K5WAB0    Localization Confidence Medium Confidence Score 11.3
NoLS Segment(s)
PositionSequenceProtein Nature
423-466HVPPHRPSSHVRHQRHRRPGEPKSRVGPRGRRHARRGTVWRGVPBasic
NLS Segment(s)
PositionSequence
429-464PSSHVRHQRHRRPGEPKSRVGPRGRRHARRGTVWRG
Subcellular Location(s) nucl 9cyto 9cyto_nucl 9
Family & Domain DBs
InterPro View protein in InterPro  
IPR027417  P-loop_NTPase  
KEGG pco:PHACADRAFT_174326  -  
Amino Acid Sequences MAHILAAEYELLGGDTPEDEATEHAFRTAPVFTGDALNALGANVLPQRAVYGRVLSQSADGFPSHPASPILYINTNTPFSGLVCGLQGTGKSHSTSVLLESCLMADPRLGTLPEPLSALVFHFDTAAGGGNVQPCEAAYLSALHVRRGGNVAAPSVTVLVLPSNIQAMREVYAELPAVKVKPLHFSPEDINGERLLAMMKVDENGQIPLYMEAVMSLLRDTEGPFDYNKFREDLKAQPLNGTQRTMLNLRLSLLDSCLKGGSAENRVTVHFRKGQLTIIDLSSPFMDGSSACGFFDLILGLFIQADIKPSGKVVVLDEAHKYLSDAQSGTSSRLTQSLLTIIRQQRHLATRVIISTQEPTVVPSKFIALCSFIIAHRFQSPEWLRLLTKHVSVPNNSFDELFSRVRIPLPLHDRISQTARTAHVPPHRPSSHVRHQRHRRPGEPKSRVGPRGRRHARRGTVWRGVPPRPVPLACDARRRPLHPCGARPSAYHPRRARWS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.05
2 0.05
3 0.06
4 0.06
5 0.07
6 0.07
7 0.08
8 0.12
9 0.14
10 0.14
11 0.14
12 0.14
13 0.14
14 0.16
15 0.16
16 0.13
17 0.13
18 0.14
19 0.14
20 0.16
21 0.16
22 0.14
23 0.13
24 0.12
25 0.1
26 0.09
27 0.08
28 0.05
29 0.07
30 0.08
31 0.08
32 0.08
33 0.08
34 0.1
35 0.11
36 0.14
37 0.14
38 0.17
39 0.18
40 0.21
41 0.22
42 0.2
43 0.21
44 0.2
45 0.19
46 0.17
47 0.15
48 0.13
49 0.15
50 0.17
51 0.16
52 0.16
53 0.16
54 0.16
55 0.18
56 0.19
57 0.21
58 0.2
59 0.21
60 0.23
61 0.26
62 0.25
63 0.23
64 0.21
65 0.18
66 0.16
67 0.18
68 0.14
69 0.11
70 0.1
71 0.11
72 0.1
73 0.11
74 0.11
75 0.11
76 0.14
77 0.15
78 0.16
79 0.16
80 0.17
81 0.17
82 0.17
83 0.17
84 0.16
85 0.15
86 0.14
87 0.14
88 0.13
89 0.14
90 0.13
91 0.1
92 0.08
93 0.08
94 0.09
95 0.11
96 0.11
97 0.1
98 0.13
99 0.14
100 0.14
101 0.14
102 0.13
103 0.12
104 0.12
105 0.12
106 0.1
107 0.09
108 0.08
109 0.07
110 0.07
111 0.07
112 0.07
113 0.08
114 0.06
115 0.06
116 0.07
117 0.1
118 0.1
119 0.1
120 0.09
121 0.08
122 0.1
123 0.1
124 0.08
125 0.06
126 0.08
127 0.09
128 0.14
129 0.14
130 0.13
131 0.16
132 0.16
133 0.17
134 0.18
135 0.17
136 0.16
137 0.17
138 0.17
139 0.14
140 0.13
141 0.12
142 0.1
143 0.1
144 0.06
145 0.05
146 0.05
147 0.05
148 0.05
149 0.05
150 0.07
151 0.07
152 0.07
153 0.08
154 0.09
155 0.1
156 0.1
157 0.1
158 0.08
159 0.09
160 0.1
161 0.09
162 0.09
163 0.09
164 0.09
165 0.09
166 0.11
167 0.11
168 0.16
169 0.17
170 0.22
171 0.22
172 0.24
173 0.25
174 0.3
175 0.33
176 0.28
177 0.28
178 0.22
179 0.22
180 0.19
181 0.17
182 0.1
183 0.06
184 0.05
185 0.05
186 0.05
187 0.05
188 0.06
189 0.07
190 0.07
191 0.07
192 0.08
193 0.07
194 0.08
195 0.07
196 0.07
197 0.06
198 0.05
199 0.05
200 0.05
201 0.05
202 0.04
203 0.04
204 0.04
205 0.04
206 0.04
207 0.04
208 0.07
209 0.08
210 0.08
211 0.09
212 0.11
213 0.14
214 0.15
215 0.16
216 0.15
217 0.14
218 0.16
219 0.19
220 0.21
221 0.27
222 0.29
223 0.29
224 0.29
225 0.32
226 0.34
227 0.32
228 0.28
229 0.21
230 0.18
231 0.2
232 0.19
233 0.18
234 0.14
235 0.13
236 0.13
237 0.13
238 0.13
239 0.11
240 0.11
241 0.11
242 0.1
243 0.1
244 0.09
245 0.08
246 0.08
247 0.09
248 0.1
249 0.13
250 0.13
251 0.14
252 0.15
253 0.16
254 0.19
255 0.19
256 0.2
257 0.21
258 0.22
259 0.23
260 0.23
261 0.26
262 0.23
263 0.23
264 0.2
265 0.16
266 0.15
267 0.12
268 0.12
269 0.09
270 0.09
271 0.07
272 0.05
273 0.05
274 0.04
275 0.08
276 0.09
277 0.1
278 0.09
279 0.09
280 0.09
281 0.09
282 0.09
283 0.06
284 0.04
285 0.04
286 0.04
287 0.04
288 0.04
289 0.04
290 0.04
291 0.04
292 0.06
293 0.07
294 0.07
295 0.07
296 0.08
297 0.09
298 0.09
299 0.09
300 0.09
301 0.13
302 0.13
303 0.15
304 0.16
305 0.15
306 0.15
307 0.14
308 0.14
309 0.12
310 0.12
311 0.12
312 0.11
313 0.11
314 0.15
315 0.16
316 0.17
317 0.15
318 0.14
319 0.13
320 0.15
321 0.15
322 0.12
323 0.12
324 0.15
325 0.15
326 0.15
327 0.22
328 0.25
329 0.27
330 0.29
331 0.29
332 0.3
333 0.33
334 0.35
335 0.3
336 0.27
337 0.26
338 0.26
339 0.25
340 0.21
341 0.17
342 0.16
343 0.14
344 0.14
345 0.12
346 0.13
347 0.17
348 0.16
349 0.16
350 0.14
351 0.17
352 0.17
353 0.18
354 0.17
355 0.15
356 0.15
357 0.15
358 0.16
359 0.13
360 0.15
361 0.15
362 0.16
363 0.16
364 0.17
365 0.16
366 0.25
367 0.27
368 0.27
369 0.29
370 0.3
371 0.27
372 0.28
373 0.33
374 0.26
375 0.26
376 0.27
377 0.31
378 0.33
379 0.36
380 0.37
381 0.38
382 0.38
383 0.36
384 0.32
385 0.26
386 0.24
387 0.25
388 0.23
389 0.19
390 0.18
391 0.18
392 0.19
393 0.22
394 0.21
395 0.25
396 0.31
397 0.36
398 0.38
399 0.41
400 0.42
401 0.43
402 0.45
403 0.39
404 0.35
405 0.32
406 0.31
407 0.31
408 0.31
409 0.34
410 0.38
411 0.44
412 0.45
413 0.51
414 0.5
415 0.5
416 0.54
417 0.56
418 0.59
419 0.61
420 0.66
421 0.67
422 0.77
423 0.84
424 0.88
425 0.88
426 0.86
427 0.86
428 0.88
429 0.88
430 0.85
431 0.82
432 0.8
433 0.8
434 0.79
435 0.78
436 0.78
437 0.75
438 0.78
439 0.82
440 0.83
441 0.82
442 0.85
443 0.83
444 0.83
445 0.84
446 0.82
447 0.8
448 0.75
449 0.75
450 0.71
451 0.67
452 0.66
453 0.6
454 0.57
455 0.54
456 0.51
457 0.46
458 0.47
459 0.53
460 0.5
461 0.57
462 0.54
463 0.58
464 0.64
465 0.64
466 0.62
467 0.61
468 0.67
469 0.64
470 0.69
471 0.67
472 0.68
473 0.67
474 0.62
475 0.62
476 0.62
477 0.59
478 0.61
479 0.59